You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycine dehydrogenase [decarboxylating], mitochondrial
Synonyms
  • Glycine cleavage system P protein
  • Glycine decarboxylase
  • Glycine decarboxylase complex subunit P
Gene NameGCV2
Enzyme Class
Biological Properties
General FunctionInvolved in glycine dehydrogenase (decarboxylating) activity
Specific FunctionThe glycine cleavage system (glycine decarboxylase complex) catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity, acting on the CH-NH2 group of donors
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH2 group of donors, disulfide as acceptor
glycine dehydrogenase (decarboxylating) activity
Process
glycine metabolic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
oxidation reduction
serine family amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR189W
Gene Sequence>3105 bp ATGCTTAGGACAAGAGTGACTGCTCTCCTTTGTAGGGCTACTGTCAGGTCAAGCACCAAT TATGTTTCATTAGCGAGGACTAGATCATTCCATTCTCAATCTATTTTGCTCAAAACAGCC GCTACAGACATAACGTCTACACAGTACAGCAGGATTTTCAATCCTGACTTGAAAAACATT GATAGACCGCTAGATACTTTTGCTAGACGTCATTTAGGTCCTTCTCCTAGCGACGTTAAG AAAATGTTAAAAACAATGGGTTATAGCGATTTAAACGCATTTATAGAAGAGCTCGTTCCT CCCAATATTTTGAAGAGAAGACCCTTGAAACTAGAAGCTCCTAGTAAGGGATTCTGTGAA CAAGAAATGCTTCAACATCTAGAAAAGATTGCCAATAAGAACCACTATAAAGTTAAAAAT TTCATAGGTAAGGGTTACTACGGTACGATTTTACCACCGGTTATACAAAGAAACCTGCTA GAAAGTCCAGAATGGTATACTTCTTATACGCCCTATCAACCCGAAATTTCTCAAGGTAGG CTAGAAGCGCTATTAAACTTTCAAACGGTTGTTTCAGATTTGACTGGTTTGCCTGTGGCG AACGCCTCATTGTTGGATGAGGGTACAGCGGCTGGAGAAGCTATGCTCTTGTCATTCAAT ATTTCCAGAAAAAAGAAACTAAAATACGTAATAGATAAAAAATTACACCAGCAAACAAAG AGTGTCCTTCACACCAGAGCCAAGCCGTTCAATATTGAAATTATTGAAGTTGACTGTTCG GATATCAAGAAAGCTGTGGATGTTTTAAAGAACCCCGACGTATCTGGTTGTTTGGTTCAA TATCCAGCGACAGATGGTTCAATCTTACCGCCTGACTCGATGAAACAGTTATCTGATGCG TTACACTCTCACAAGTCTTTGCTCTCTGTGGCCTCAGATTTAATGGCTTTGACACTTCTA AAACCACCTGCTCATTACGGTGCTGATATCGTCCTGGGTTCCTCTCAACGATTTGGTGTC CCAATGGGTTATGGTGGTCCTCATGCTGCTTTTTTCGCTGTTATTGATAAATTAAACAGA AAAATTCCAGGTAGAATTGTCGGTATCTCTAAAGACCGCTTAGGCAAGACGGCCTTGCGG TTGGCCCTCCAAACAAGAGAACAACATATCAAGCGTGATAAGGCAACTTCAAATATATGT ACCGCTCAAGCTTTACTGGCTAATGTTGCTTCGAGCTACTGTGTTTATCACGGTCCTAAG GGCCTACAGAATATTTCCAGGAGGATATTTAGCTTAACATCAATATTGGCAAATGCCATC GAAAATGACAGTTGCCCTCACGAACTAATTAATAAAACATGGTTTGATACTTTGACTATA AAGTTAGGTAATGGCATATCCTCCGAGCAGTTATTGGACAAGGCCTTGAAAGAATTTAAT ATCAATTTGTTTGCCGTGGACACCACCACTATTTCCTTGGCTCTTGATGAAACAACTACA AAAGCTGATGTTGAAAATCTACTAAAAGTGTTTGACATTGAAAATTCTTCGCAGTTTCTT TCTGAGGACTATTCTAACAGTTTCCCAAGGGAATTTCAGCGTACTGATGAAATATTGAGG AACGAAGTCTTTCACATGCACCATAGCGAAACAGCAATGTTGAGATATTTACATAGGTTG CAATCTCGTGATTTATCTCTTGCTAATTCTATGATTCCTTTAGGTTCCTGTACTATGAAA TTGAACAGTACTGTTGAAATGATGCCAATCACTTGGCCCCAATTTTCGAATATCCATCCG TTCCAGCCATCAAACCAAGTCCAAGGATACAAGGAACTAATTACTTCGTTGGAGAAAGAT TTATGCAGCATTACAGGTTTCGATGGTATTTCTTTACAACCAAATTCAGGTGCTCAAGGT GAATATACTGGTCTGAGAGTAATCAGATCCTACCTGGAAAGCAAAGGTGAAAATCATCGT AACGTGTGTTTAATCCCTGTATCCGCTCATGGTACAAATCCGGCTTCTGCCGCTATGGCG GGTTTAAAAGTTGTTCCTGTCAACTGTTTGCAGGATGGCTCATTAGATCTGGTTGACTTA AAGAATAAGGCTGAACAACATTCTAAAGAACTAGCCGCCGTAATGATCACCTATCCTTCC ACTTACGGTTTATTTGAACCAGGCATCCAACATGCTATTGATATCGTACATTCTTTTGGT GGACAAGTCTATTTGGATGGTGCTAATATGAATGCGCAGGTTGGGCTAACTTCACCCGGA GATCTTGGTGCAGATGTTTGCCACTTGAATTTACATAAGACATTTTCCATTCCTCATGGT GGTGGTGGTCCAGCTGGAGCTCCCATTTGCGTCAAATCTCATTTAATACCCCATTTACCT AAACATGACGTTGTTGATATGATCACTGGAATCGGCGGTAGCAAATCCATCGATTCGGTC TCCTCTGCTCCATATGGTAATGCTTTAGTGTTACCAATTTCTTATGCCTATATCAAAATG ATGGGTAATGAGGGATTACCATTTTCTAGTGTGATAGCAATGCTAAATTCAAATTATATG ATGACAAGATTAAAAGATCATTATAAAATTCTTTTCGTCAATGAAATGAGCACACTAAAA CACTGCGCTCATGAATTTATAGTTGATCTAAGAGAATACAAAGCTAAAGGTGTTGAAGCT ATCGATGTTGCCAAGAGATTGCAAGACTACGGATTCCATGCCCCAACGTTGGCCTTCCCT GTTCCCGGAACTTTGATGATAGAACCAACAGAATCGGAAAACTTGGAAGAATTGGATAGA TTCTGTGATGCCATGATATCCATCAAAGAAGAAATAAATGCCTTAGTAGCAGGTCAACCA AAAGGACAGATTTTGAAAAATGCCCCTCATTCATTGGAAGATCTTATTACTTCCTCCAAT TGGGATACGAGAGGTTATACCCGTGAAGAAGCCGCTTACCCATTACCCTTTTTGAGATAC AATAAATTCTGGCCTACTGTCGCTAGACTGGATGACACTTATGGTGACATGAATTTAATA TGTACATGCCCTTCTGTAGAAGAAATTGCGAACGAAACTGAATGA
Protein Properties
Pfam Domain Function
Protein Residues1034
Protein Molecular Weight114450.0
Protein Theoretical pI7.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycine dehydrogenase [decarboxylating], mitochondrial MLRTRVTALLCRATVRSSTNYVSLARTRSFHSQSILLKTAATDITSTQYSRIFNPDLKNI DRPLDTFARRHLGPSPSDVKKMLKTMGYSDLNAFIEELVPPNILKRRPLKLEAPSKGFCE QEMLQHLEKIANKNHYKVKNFIGKGYYGTILPPVIQRNLLESPEWYTSYTPYQPEISQGR LEALLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLLSFNISRKKKLKYVIDKKLHQQTK SVLHTRAKPFNIEIIEVDCSDIKKAVDVLKNPDVSGCLVQYPATDGSILPPDSMKQLSDA LHSHKSLLSVASDLMALTLLKPPAHYGADIVLGSSQRFGVPMGYGGPHAAFFAVIDKLNR KIPGRIVGISKDRLGKTALRLALQTREQHIKRDKATSNICTAQALLANVASSYCVYHGPK GLQNISRRIFSLTSILANAIENDSCPHELINKTWFDTLTIKLGNGISSEQLLDKALKEFN INLFAVDTTTISLALDETTTKADVENLLKVFDIENSSQFLSEDYSNSFPREFQRTDEILR NEVFHMHHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNSTVEMMPITWPQFSNIHP FQPSNQVQGYKELITSLEKDLCSITGFDGISLQPNSGAQGEYTGLRVIRSYLESKGENHR NVCLIPVSAHGTNPASAAMAGLKVVPVNCLQDGSLDLVDLKNKAEQHSKELAAVMITYPS TYGLFEPGIQHAIDIVHSFGGQVYLDGANMNAQVGLTSPGDLGADVCHLNLHKTFSIPHG GGGPAGAPICVKSHLIPHLPKHDVVDMITGIGGSKSIDSVSSAPYGNALVLPISYAYIKM MGNEGLPFSSVIAMLNSNYMMTRLKDHYKILFVNEMSTLKHCAHEFIVDLREYKAKGVEA IDVAKRLQDYGFHAPTLAFPVPGTLMIEPTESENLEELDRFCDAMISIKEEINALVAGQP KGQILKNAPHSLEDLITSSNWDTRGYTREEAAYPLPFLRYNKFWPTVARLDDTYGDMNLI CTCPSVEEIANETE
References
External Links
ResourceLink
Saccharomyces Genome Database GCV2
Uniprot IDP49095
Uniprot NameGCSP_YEAST
GenBank Gene IDU20641
Genebank Protein ID676871
General Reference
  • Sinclair, D. A., Hong, S. P., Dawes, I. W. (1996). "Specific induction by glycine of the gene for the P-subunit of glycine decarboxylase from Saccharomyces cerevisiae." Mol Microbiol 19:611-623.8830251
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106