You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamyl-tRNA synthetase, mitochondrial
Synonyms
  • Glutamate--tRNA ligase
  • GluRS
Gene NameMSE1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction:glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Glu) + L-Glutamic acidAdenosine monophosphate + Pyrophosphate + Glu-tRNA(Glu)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00271L-Glutamic acidShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
nucleoside binding
purine nucleoside binding
glutamate-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
Process
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
glutamyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 15
LocusYOL033W
Gene Sequence>1611 bp ATGATCATGTTGAGAATACCGACACGGTCTTATTGTTCACCTTCGAAGCTAATAAAGGGC GTAGGTCTCTCACCATTGAAGAAATCTCTGTTATCCAAGAAAATAAAGGAAGATATCCAT CCTTCTTTACCTGTTAGAACTAGGTTTGCGCCTTCTCCAACTGGGTTTTTACACTTGGGG TCACTGAGAACAGCCCTTTACAATTACCTATTAGCAAGAAACACCAATGGGCAGTTTTTG CTTCGTTTAGAAGATACAGACCAGAAGAGGCTAATAGAGGGAGCAGAAGAAAACATCTAC GAGATTCTGAAATGGTGTAACATAAACTACGATGAAACCCCTATAAAGCAAAGTGAAAGG AAACTAATATATGACAAATATGTAAAAATATTACTATCTTCTGGGAAGGCGTATAGATGT TTTTGTTCAAAGGAGCGATTGAACGATTTGAGACACTCTGCAATGGAATTGAAACCTCCT TCGATGGCAAGCTATGATCGATGTTGTGCACACTTAGGGGAGGAAGAAATAAAATCTAAG CTAGCGCAAGGTATACCTTTCACTGTGCGGTTTAAATCGCCAGAACGATATCCAACGTTT ACTGATCTTTTACATGGACAAATAAATCTTCAACCGCAAGTAAACTTTAACGATAAACGG TACGATGACCTTATCCTTGTTAAGTCGGATAAGTTGCCAACCTATCATCTGGCAAATGTT GTGGATGACCATTTGATGGGAATAACCCATGTTATAAGAGGTGAGGAATGGCTGCCCTCT ACTCCTAAACATATCGCCCTATATAATGCATTTGGGTGGGCTTGCCCAAAGTTCATCCAC ATTCCCTTATTGACGACGGTTGGTGATAAGAAATTGAGTAAAAGAAAAGGTGATATGTCT ATCTCGGATTTAAAAAGACAGGGAGTTTTGCCAGAAGCTTTGATTAACTTTTGTGCGCTA TTTGGCTGGTCTCCTCCAAGAGATCTGGCTTCGAAAAAGCATGAGTGTTTTTCAATGGAG GAATTGGAAACCATTTTTAATTTGAATGGTTTGACGAAGGGAAATGCCAAAGTCGATGAT AAAAAATTGTGGTTCTTCAATAAGCATTTTTTGCAAAAAAGAATACTTAATCCTTCTACA TTGAGGGAGCTTGTCGACGACATTATGCCTTCTTTAGAGTCCATATATAACACATCTACC ATAAGCCGTGAGAAAGTAGCTAAAATTTTACTGAACTGTGGTGGTTCTCTATCAAGGATT AACGATTTTCATGATGAATTTTATTATTTTTTTGAAAAGCCCAAATATAATGATAATGAT GCTGTCACGAAATTTCTAAGCAAGAACGAAAGCCGCCACATTGCTCACTTATTGAAGAAG CTTGGACAGCTTCAAGAGGGCACCGATGCTCAAGAAGTCGAATCTATGGTCGAAACGATG TATTATGAGAACGGTTTTTCTAGGAAAGTCACGTATCAGGCAATGAGATTTGCTCTTGCG GGATGTCACCCAGGTGCCAAAATAGCAGCCATGATAGATATTTTGGGCATCAAGGAAAGT AACAAAAGATTATCCGAAGGTTTACAGTTCTTGCAAAGAGAGAAAAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues536
Protein Molecular Weight61602.69922
Protein Theoretical pI9.48
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamyl-tRNA synthetase, mitochondrial MIMLRIPTRSYCSPSKLIKGVGLSPLKKSLLSKKIKEDIHPSLPVRTRFAPSPTGFLHLG SLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILKWCNINYDETPIKQSER KLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMASYDRCCAHLGEEEIKSK LAQGIPFTVRFKSPERYPTFTDLLHGQINLQPQVNFNDKRYDDLILVKSDKLPTYHLANV VDDHLMGITHVIRGEEWLPSTPKHIALYNAFGWACPKFIHIPLLTTVGDKKLSKRKGDMS ISDLKRQGVLPEALINFCALFGWSPPRDLASKKHECFSMEELETIFNLNGLTKGNAKVDD KKLWFFNKHFLQKRILNPSTLRELVDDIMPSLESIYNTSTISREKVAKILLNCGGSLSRI NDFHDEFYYFFEKPKYNDNDAVTKFLSKNESRHIAHLLKKLGQFQEGTDAQEVESMVETM YYENGFSRKVTYQAMRFALAGCHPGAKIAAMIDILGIKESNKRLSEGLQFLQREKK
References
External Links
ResourceLink
Saccharomyces Genome Database MSE1
Uniprot IDP48525
Uniprot NameSYEM_YEAST
GenBank Gene IDL39015
Genebank Protein ID625182
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106