You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCystathionine gamma-synthase
Synonyms
  • O-succinylhomoserine (thiol)-lyase
  • Sulfur transfer protein 2
Gene NameSTR2
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionO(4)-succinyl-L-homoserine + L-cysteine = L- cystathionine + succinate
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Selenocystathionine + O-Succinyl-L-homoserineSelenocysteine + Succinic acid
Selenocysteine + AcetylhomoserineSelenocystathionine + Acetic acid
KEGG Reactions
L-Cysteine + O-Acetyl-L-homoserineAcetic acid + L-Cystathionine + hydron
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00056Acetic acidShow
YMDB00158O-Acetyl-L-homoserineShow
YMDB00245L-CystathionineShow
YMDB00338Succinic acidShow
YMDB00862hydronShow
YMDB00917O-Succinyl-L-homoserineShow
YMDB16154SelenocysteineShow
YMDB16184SelenocystathionineShow
YMDB16245AcetylhomoserineShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
catalytic activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR130C
Gene Sequence>1920 bp ATGATATCTAGAACCATTGGTGAATCTATTCCGCCCAACACAAAACATGCTGTTTCCGTG TGTTTGCCCACATGGGAAGCTACAGTAGGCTATGAAGAGGGTGAAAGCAGTATAATTAAC TCGCTTACTACCGGATATCCAAGATTTTTCATACACAAGTCAATAAAGAAATTATGTGAA ATTTTATCCGCTAAGTACTCCATGGAAGATGAAGCTTGTCTTTGCTTCCCCTCTTACAAG GTTGCCAATAGGTGCAGAGAGTTTATCAAAGTGAAAACGGGTCTTTCTACCAAAGTACGC ATCTTACAACTATGTACACCTAAACCTATGAACCAAGAGGAAAAGCTCTGGAGAAGGGAA TGTAAAATCACGGTGGTGTTTGTAGACCAGGAAATATTCCCCGTGATGAAGCAGTATTGG CAACATTCTGGTGAGATTGTATCTAGCAGAATGGCGGAGTATATTTTACATGAATTACAA GTCAAGGATAATCTTAAGAAGATGGAAACAGTGGATAACGGTAAAAAATTTATGACCGAA GATGAAAACAGAGTGAACGAAGAATATATAGAAACGAGATTTGGGAGAAATTTAAATTTT CTTGCTGCTGATAAAGCCAAATATCTAATACGAAAGAGGATTGCCACAAAAGTTGTTGAA AAAATTGACTCTGAAGGTCTATCGGACCTATTCTCTTTTGAACACTATAACGAGAGCAAC GGTCCATTCAATGTTGGCAGTGGAGAGGCTCTGGATGATGATCAGTTGAATTCGGACATA CCTGCCGAAACAATTACTTCTATGGGAGAAAGTGGCTCAAACAGTACTTTTGAAAACACA GCTACCGATGACTTGAAGTTTCATGTCAACCCTAATACGGATGTTTACTTATTTCCAAGT GGAATGGCGTCCATTTTCACTGCCCACAGGCTGCTTTTAAACTTCGATGCCAAGCGCTTA TCAAGGTCTTCTAGTAGACAAGATAAGTTGATTGGATATGGACCTCCGTTCAAGAAGACC GTCATGTTTGGATTCCCATATACAGATACTCTGAGCATTCTTCGGAAGTTCAATCACACA CATTTCTTGGGACAGGGAGATTCAACGTCAATGAACGCTCTGAAAAATATTTTACATTCT GGTGAGCAAATACTGGCGGTATTTATAGAAGCTCCATCGAACCCACTGTTGAAAATGGGA GATTTACAAGAACTGAAAAGGCTATCAGACTTGTATTCATTTTACATAGTGGTCGATGAA ACTGTGGGTGGCTTTGTCAATATAGATGTATTACCGTATGCCGATATTGTTTGTAGTTCG CTAACGAAAATCTTCAGCGGCGACTCGAACGTTATTGCAGGATCCTTAGTACTAAATCCT AGAGGAAAGATTTATGAGTTTGCTAGAAAATTTATGAAGACTGAAGACGGATATGAAGAT TGCCTATGGTGCGAAGATGCGTTATGCCTGGAAAGAAATTCGAGAGACTTCGTGGAACGT ACAATCAAGGTGAATACAAACACTGATATATTGTTAAAAAGGGTGTTATTGCCTCAGGTG GGAAAATTGTTCAAGAAAATATATTACCCCAGTTTAACATCAGAGGATACCAAGCGGAAT TATGACAGCGTTATGTCTACAAAAGATGGTGGGTATGGAGGTTTATTTTCACTAACTTTT TTCAATATTGAAGAGGCAAAGAAGTTTTTCAATAATCTGGAATTGTGCAAAGGACCTTCT CTCGGTACGAATTTCACTTTGGCGTGTCCATATGCTATTATTGCCCACTACCAGGAATTA GACGAGGTAGCTCAATATGGTGTCGAAACAAATCTTGTAAGAGTGAGCGTCGGTTTGGAA AATAGCGACGTTTTATGCAATGTTTTTCAGCGTGCCATTGAGAAAGCTTTAGGGGAATAA
Protein Properties
Pfam Domain Function
Protein Residues639
Protein Molecular Weight72349.89844
Protein Theoretical pI5.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cystathionine gamma-synthase MISRTIGESIPPNTKHAVSVCLPTWEATVGYEEGESSIINSLTTGYPRFFIHKSIKKLCE ILSAKYSMEDEACLCFPSYKVANRCREFIKVKTGLSTKVRILQLCTPKPMNQEEKLWRRE CKITVVFVDQEIFPVMKQYWQHSGEIVSSRMAEYILHELQVKDNLKKMETVDNGKKFMTE DENRVNEEYIETRFGRNLNFLAADKAKYLIRKRIATKVVEKIDSEGLSDLFSFEHYNESN GPFNVGSGEALDDDQLNSDIPAETITSMGESGSNSTFENTATDDLKFHVNPNTDVYLFPS GMASIFTAHRLLLNFDAKRLSRSSSRQDKLIGYGPPFKKTVMFGFPYTDTLSILRKFNHT HFLGQGDSTSMNALKNILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDE TVGGFVNIDVLPYADIVCSSLTKIFSGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYED CLWCEDALCLERNSRDFVERTIKVNTNTDILLKRVLLPQVGKLFKKIYYPSLTSEDTKRN YDSVMSTKDGGYGGLFSLTFFNIEEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQEL DEVAQYGVETNLVRVSVGLENSDVLCNVFQRAIEKALGE
References
External Links
ResourceLink
Saccharomyces Genome Database STR2
Uniprot IDP47164
Uniprot NameMET7_YEAST
GenBank Gene IDAY692979
Genebank Protein ID51013409
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Hansen, J., Johannesen, P. F. (2000). "Cysteine is essential for transcriptional regulation of the sulfur assimilation genes in Saccharomyces cerevisiae." Mol Gen Genet 263:535-542.10821189
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106