You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSuccinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial
Synonyms
  • Flavoprotein subunit of complex II
  • FP
  • SDH1b
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionProbable minor catalytic subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Probably forms a catalytic dimer with SDH2. Electrons flow from succinate to the FAD bound to the catalytic subunit, and sequentially through the iron-sulfur clusters bound to SDH2 and enter the membrane dimer formed by SDH3 and SDH4
Cellular LocationMitochondrion inner membrane; Peripheral membrane protein; Matrix side
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00088Ubiquinone Q1Show
YMDB00101Fumaric acidShow
YMDB00338Succinic acidShow
YMDB00902ubiquinolShow
GO Classification
Component
Not Available
Function
electron carrier activity
binding
nucleoside binding
purine nucleoside binding
oxidoreductase activity, acting on the CH-CH group of donors
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
catalytic activity
Process
cellular metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
generation of precursor metabolites and energy
electron transport chain
oxidation reduction
cofactor metabolic process
metabolic process
coenzyme metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYJL045W
Gene Sequence>1905 bp ATGTTATCTTTGAAAAAAGGAATAACAAAATCATACATCTTGCAAAGAACTTTCACTTCT TCCTCTGTTGTTCGTCAAATTGGGGAAGTGAAATCTGAATCGAAACCGCCGGCCAAATAT CATATTATCGACCATGAATATGATTGTGTGGTGGTAGGCGCTGGCGGTGCAGGTTTAAGA GCAGCTTTCGGTTTGGCTGAAGCTGGATACAAGACTGCTTGTTTATCCAAGTTGTTTCCA ACAAGGTCACATACTGTGGCTGCTCAGGGTGGAATTAATGCTGCGCTGGGAAATATGCAT CCAGATGATTGGAAATCGCACATGTACGACACTGTCAAGGGTTCTGACTGGCTCGGAGAC CAAGATGCAATCCATTACATGACAAGAGAAGCACCTAAGTCTGTCATTGAACTAGAACAT TACGGTATGCCCTTTTCGAGGACTGAAGATGGAAGGATTTACCAGAGAGCATTTGGGGGA CAATCCAAAGATTTTGGTAAAGGTGGACAGGCCTATAGGACTTGTGCGGTGGCAGATAGA ACAGGTCACGCAATGCTTCATACATTGTATGGACAAGCGCTGAAAAATAATACACACTTC TTTATTGAATACTTTGCAATGGATTTGTTGACCCATAATGGCGAGGTTGTGGGTGTCATT GCCTATAATCAGGAGGACGGTACAATTCACAGATTCAGAGCACATAAGACCGTCATCGCG ACAGGCGGATACGGTAGAGCTTACTTCTCTTGCACTTCTGCTCACACTTGTACAGGTGAC GGTAATGCTATGGTTTCTCGCGCTGGATTTCCACTAGAGGATTTAGAATTTGTTCAATTT CATCCGTCAGGAATTTATGGGTCTGGCTGCCTAATCACTGAAGGTGCCCGTGGTGAGGGT GGATTTTTATTGAATTCTGAAGGAGAAAGGTTTATGGAACGCTATGCTCCTACTGCCAAG GACTTGGCAAGCAGGGATGTTGTTTCCAGAGCAATCACCATGGAAATCAGGGCTGGCAGA GGTGTCGGGAAAAACAAGGATCATATCCTTTTACAATTAAGCCATCTACCACCTGAGGTA CTAAAGGAAAGGCTACCGGGAATATCTGAAACAGCTGCTGTCTTTGCGGGTGTCGATGTC ACCCAGGAGCCAATTCCTGTCTTGCCAACTGTCCATTATAATATGGGAGGCATTCCCACA AAATGGACTGGTGAAGCATTGACCATTGACGAGGAAACTGGAGAGGATAAGGTCATCCCA GGATTGATGGCGTGTGGTGAAGCTGCTTGCGTATCGGTTCATGGAGCGAACAGATTAGGC GCTAACTCACTACTGGATTTAGTCGTTTTCGGTCGCGCCGTTGCAAATACCATTGCTGAC ACATTACAGCCTGGCTTGCCTCATAAGCCATTGGCTTCAAACATCGGGCACGAGTCAATT GCTAATTTGGATAAAGTAAGAAATGCTCGCGGCTCACTGAAAACCTCTCAAATCAGGTTG AACATGCAAAGGACAATGCAAAAAGATGTTTCTGTTTTCAGGACGCAAGACACTCTAGAT GAAGGTGTTAGAAATATTACTGAAGTGGACAAGACATTTGAGGATGTGCACGTTTCTGAT AAGTCAATGATCTGGAATTCTGATCTCGTAGAAACTCTGGAATTGCAAAATTTACTTACT TGTGCCACACAAACGGCTGTTTCTGCTTCCAAAAGAAAGGAGTCTCGTGGTGCTCATGCG AGAGAGGACTATGCAAAAAGAGATGATGTGAATTGGAGAAAGCACACATTATCATGGCAA AAGGGGACATCAACACCTGTAAAAATCAAGTACAGGAATGTAATCGCACATACTTTAGAT GAGAATGAATGCGCCCCAGTCCCTCCAGCTGTCAGATCCTATTAA
Protein Properties
Pfam Domain Function
Protein Residues634
Protein Molecular Weight69382.0
Protein Theoretical pI7.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial MLSLKKGITKSYILQRTFTSSSVVRQIGEVKSESKPPAKYHIIDHEYDCVVVGAGGAGLR AAFGLAEAGYKTACLSKLFPTRSHTVAAQGGINAALGNMHPDDWKSHMYDTVKGSDWLGD QDAIHYMTREAPKSVIELEHYGMPFSRTEDGRIYQRAFGGQSKDFGKGGQAYRTCAVADR TGHAMLHTLYGQALKNNTHFFIEYFAMDLLTHNGEVVGVIAYNQEDGTIHRFRAHKTVIA TGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLEDLEFVQFHPSGIYGSGCLITEGARGEG GFLLNSEGERFMERYAPTAKDLASRDVVSRAITMEIRAGRGVGKNKDHILLQLSHLPPEV LKERLPGISETAAVFAGVDVTQEPIPVLPTVHYNMGGIPTKWTGEALTIDEETGEDKVIP GLMACGEAACVSVHGANRLGANSLLDLVVFGRAVANTIADTLQPGLPHKPLASNIGHESI ANLDKVRNARGSLKTSQIRLNMQRTMQKDVSVFRTQDTLDEGVRNITEVDKTFEDVHVSD KSMIWNSDLVETLELQNLLTCATQTAVSASKRKESRGAHAREDYAKRDDVNWRKHTLSWQ KGTSTPVKIKYRNVIAHTLDENECAPVPPAVRSY
References
External Links
ResourceLink
Saccharomyces Genome Database YJL045W
Uniprot IDP47052
Uniprot NameDHSX_YEAST
GenBank Gene IDZ49320
Genebank Protein ID1008175
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Colby, G., Ishii, Y., Tzagoloff, A. (1998). "Suppression of sdh1 mutations by the SDH1b gene of Saccharomyces cerevisiae." Yeast 14:1001-1006.9730279