You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePotassium-activated aldehyde dehydrogenase, mitochondrial
Synonyms
  • K(+)-activated acetaldehyde dehydrogenase
  • K(+)-ACDH
Gene NameALD4
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionAn aldehyde + NAD(+) + H(2)O = an acid + NADH
Cellular LocationMitochondrion matrix
SMPDB Pathways
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
threonine metabolismPW002401 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Fatty acid metabolismec00071 Map00071
Glycerolipid metabolismec00561 Map00561
Glycolysis / Gluconeogenesisec00010 Map00010
Histidine metabolismec00340 Map00340
SMPDB Reactions
Acetaldehyde + Coenzyme A + NADNADH + hydron + Acetyl-CoA
KEGG Reactions
NADP + Acetaldehyde + waterAcetic acid + NADPH + hydron
NAD + Acetaldehyde + waterNADH + Acetic acid + hydron
Indoleacetaldehyde + NAD + waterNADH + hydron + indole-3-acetate
Indoleacetaldehyde + NADP + waterNADPH + hydron + indole-3-acetate
NAD + 4-aminobutanal + waterNADH + gamma-Aminobutyric acid + hydron
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00045Coenzyme AShow
YMDB00056Acetic acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00312Acetyl-CoAShow
YMDB00335gamma-Aminobutyric acidShow
YMDB00354IndoleacetaldehydeShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00576indole-3-acetateShow
YMDB005874-aminobutanalShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR374W
Gene Sequence>1560 bp ATGTTCAGTAGATCTACGCTCTGCTTAAAGACGTCTGCATCCTCCATTGGGAGACTTCAA TTGAGATATTTCTCACACCTTCCTATGACAGTGCCTATCAAGCTGCCCAATGGGTTGGAA TATGAGCAACCAACGGGGTTGTTCATCAACAACAAGTTTGTTCCTTCTAAACAGAACAAG ACCTTCGAAGTCATTAACCCTTCCACGGAAGAAGAAATATGTCATATTTATGAAGGTAGA GAGGACGATGTGGAAGAGGCCGTGCAGGCCGCCGACCGTGCCTTCTCTAATGGGTCTTGG AACGGTATCGACCCTATTGACAGGGGTAAGGCTTTGTACAGGTTAGCCGAATTAATTGAA CAGGACAAGGATGTCATTGCTTCCATCGAGACTTTGGATAACGGTAAAGCTATCTCTTCC TCGAGAGGAGATGTTGATTTAGTCATCAACTATTTGAAATCTTCTGCTGGCTTTGCTGAT AAAATTGATGGTAGAATGATTGATACTGGTAGAACCCATTTTTCTTACACTAAGAGACAG CCTTTGGGTGTTTGTGGGCAGATTATTCCTTGGAATTTCCCACTGTTGATGTGGGCCTGG AAGATTGCCCCTGCTTTGGTCACCGGTAACACCGTCGTGTTGAAGACTGCCGAATCCACC CCATTGTCCGCTTTGTATGTGTCTAAATACATCCCACAGGCGGGTATTCCACCTGGTGTG ATCAACATTGTATCCGGGTTTGGTAAGATTGTGGGTGAGGCCATTACAAACCATCCAAAA ATCAAAAAGGTTGCCTTCACAGGGTCCACGGCTACGGGTAGACACATTTACCAGTCCGCA GCCGCAGGCTTGAAAAAAGTGACTTTGGAGCTGGGTGGTAAATCACCAAACATTGTCTTC GCGGACGCCGAGTTGAAAAAAGCCGTGCAAAACATTATCCTTGGTATCTACTACAATTCT GGTGAGGTCTGTTGTGCGGGTTCAAGGGTGTATGTTGAAGAATCTATTTACGACAAATTC ATTGAAGAGTTCAAAGCCGCTTCTGAATCCATCAAGGTGGGCGACCCATTCGATGAATCT ACTTTCCAAGGTGCACAAACCTCTCAAATGCAACTAAACAAAATCTTGAAATACGTTGAC ATTGGTAAGAATGAAGGTGCTACTTTGATTACCGGTGGTGAAAGATTAGGTAGCAAGGGT TACTTCATTAAGCCAACTGTCTTTGGTGACGTTAAGGAAGACATGAGAATTGTCAAAGAG GAAATCTTTGGCCCTGTTGTCACTGTAACCAAATTCAAATCTGCCGACGAAGTCATTAAC ATGGCGAACGATTCTGAATACGGGTTGGCTGCTGGTATTCACACCTCTAATATTAATACC GCCTTAAAAGTGGCTGATAGAGTTAATGCGGGTACGGTCTGGATAAACACTTATAACGAT TTCCACCACGCAGTTCCTTTCGGTGGGTTCAATGCATCTGGTTTGGGCAGGGAAATGTCT GTTGATGCTTTACAAAACTACTTGCAAGTTAAAGCGGTCCGTGCCAAATTGGACGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues519
Protein Molecular Weight56723.19922
Protein Theoretical pI6.72
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Potassium-activated aldehyde dehydrogenase, mitochondrial MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFINNKFVPSKQNK TFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSWNGIDPIDRGKALYRLAELIE QDKDVIASIETLDNGKAISSSRGDVDLVINYLKSSAGFADKIDGRMIDTGRTHFSYTKRQ PLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGV INIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDES TFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKE EIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYND FHHAVPFGGFNASGLGREMSVDALQNYLQVKAVRAKLDE
References
External Links
ResourceLink
Saccharomyces Genome Database ALD4
Uniprot IDP46367
Uniprot NameALDH4_YEAST
GenBank Gene IDZ75282
Genebank Protein ID1420808
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Chalmers, R. M., Keen, J. N., Fewson, C. A. (1991). "Comparison of benzyl alcohol dehydrogenases and benzaldehyde dehydrogenases from the benzyl alcohol and mandelate pathways in Acinetobacter calcoaceticus and from the TOL-plasmid-encoded toluene pathway in Pseudomonas putida. N-terminal amino acid sequences, amino acid compositions and immunological cross-reactions." Biochem J 273(Pt 1):99-107.1989592
  • Larsson, T., Norbeck, J., Karlsson, H., Karlsson, K. A., Blomberg, A. (1997). "Identification of two-dimensional gel electrophoresis resolved yeast proteins by matrix-assisted laser desorption ionization mass spectrometry." Electrophoresis 18:418-423.9150920
  • Tessier, W. D., Meaden, P. G., Dickinson, F. M., Midgley, M. (1998). "Identification and disruption of the gene encoding the K(+)-activated acetaldehyde dehydrogenase of Saccharomyces cerevisiae." FEMS Microbiol Lett 164:29-34.9675847
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666