You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucosamine 6-phosphate N-acetyltransferase
Synonyms
  • Phosphoglucosamine acetylase
  • Phosphoglucosamine transacetylase
Gene NameGNA1
Enzyme Class
Biological Properties
General FunctionInvolved in N-acetyltransferase activity
Specific FunctionAcetyl-CoA + D-glucosamine 6-phosphate = CoA + N-acetyl-D-glucosamine 6-phosphate
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
Glucosamine 6-phosphate + Acetyl-CoACoenzyme A + hydron + N-acetyl-D-glucosamine 6-phosphate
KEGG Reactions
Acetyl-CoA + Glucosamine 6-phosphateN-acetyl-D-glucosamine 6-phosphate + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00044Glucosamine 6-phosphateShow
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB00737N-acetyl-D-glucosamine 6-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
N-acetyltransferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFL017C
Gene Sequence>480 bp ATGAGCTTACCCGATGGATTTTATATAAGGCGAATGGAAGAGGGGGATTTGGAACAGGTC ACTGAGACGCTAAAGGTTTTGACCACCGTGGGCACTATTACCCCCGAATCCTTCAGCAAA CTCATAAAATACTGGAATGAAGCCACAGTATGGAATGATAACGAAGATAAAAAAATAATG CAATATAACCCCATGGTGATTGTGGACAAGCGCACCGAGACGGTTGCCGCTACGGGGAAT ATCATCATCGAAAGAAAGATCATTCATGAACTGGGGCTATGTGGCCACATCGAGGACATT GCAGTAAACTCCAAGTATCAGGGCCAAGGTTTGGGCAAGCTCTTGATTGATCAATTGGTA ACTATCGGCTTTGACTACGGTTGTTATAAGATTATTTTAGATTGCGATGAGAAAAATGTC AAATTCTATGAAAAATGTGGGTTTAGCAACGCAGGCGTGGAAATGCAAATTAGAAAATAG
Protein Properties
Pfam Domain Function
Protein Residues159
Protein Molecular Weight18134.80078
Protein Theoretical pI4.87
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glucosamine 6-phosphate N-acetyltransferase MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIM QYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLV TIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK
References
External Links
ResourceLink
Saccharomyces Genome Database GNA1
Uniprot IDP43577
Uniprot NameGNA1_YEAST
GenBank Gene IDAB017626
Genebank Protein ID4115733
PDB ID
1I1D
General Reference
  • Mio, T., Yamada-Okabe, T., Arisawa, M., Yamada-Okabe, H. (1999). "Saccharomyces cerevisiae GNA1, an essential gene encoding a novel acetyltransferase involved in UDP-N-acetylglucosamine synthesis." J Biol Chem 274:424-429.9867860
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peneff, C., Mengin-Lecreulx, D., Bourne, Y. (2001). "The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase." J Biol Chem 276:16328-16334.11278591