You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsocitrate dehydrogenase [NADP] cytoplasmic
Synonyms
  • IDH
  • IDP
  • NADP(+)-specific ICDH
  • Oxalosuccinate decarboxylase
Gene NameIDP2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionMay function in the production of NADPH for fatty acid and sterol synthesis
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glutathione metabolismec00480 Map00480
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
Isocitric acid + NADPCarbon dioxide + hydron + NADPH + Oxoglutaric acid
KEGG Reactions
NADP + Isocitric acidOxoglutaric acid + Carbon dioxide + NADPH
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00153Oxoglutaric acidShow
YMDB00210Oxalosuccinic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
catalytic activity
magnesium ion binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
binding
nucleotide binding
ion binding
isocitrate dehydrogenase activity
cation binding
NAD or NADH binding
metal ion binding
isocitrate dehydrogenase (NADP+) activity
oxidoreductase activity
Process
isocitrate metabolic process
oxidation reduction
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR174W
Gene Sequence>1239 bp ATGACAAAGATTAAGGTAGCTAACCCCATTGTGGAAATGGACGGCGATGAGCAAACAAGA ATAATCTGGCATTTAATCAGGGACAAGTTAGTCTTGCCCTATCTTGACGTTGATTTGAAG TACTACGATCTTTCCGTGGAGTATCGTGACCAGACTAATGATCAAGTAACTGTGGATTCT GCCACCGCGACTTTAAAGTATGGAGTAGCTGTCAAATGCGCGACTATTACACCCGATGAG GCAAGGGTCGAGGAATTTCATTTGAAAAAGATGTGGAAATCTCCAAATGGTACTATTAGA AACATTTTGGGTGGTACAGTGTTCAGAGAACCTATTATTATCCCTAGAATTCCAAGGCTA GTTCCTCAATGGGAGAAGCCCATCATCATTGGGAGACACGCATTCGGCGATCAGTACAAA GCTACCGATGTAATAGTCCCTGAAGAAGGCGAGTTGAGGCTTGTTTATAAATCCAAGAGC GGAACTCATGATGTAGATCTGAAGGTATTTGACTACCCAGAACATGGTGGGGTTGCCATG ATGATGTACAACACTACAGATTCGATCGAAGGGTTTGCGAAGGCCTCCTTTGAATTGGCC ATTGAAAGGAAGTTACCATTATATTCCACTACTAAGAATACTATTTTGAAGAAGTATGAT GGTAAATTCAAAGATGTTTTCGAAGCCATGTATGCTAGAAGTTATAAAGAGAAGTTTGAA TCCCTTGGCATCTGGTACGAGCACCGTTTAATTGATGATATGGTGGCCCAAATGTTGAAA TCTAAAGGTGGATACATAATTGCCATGAAAAATTACGACGGTGACGTAGAATCAGATATT GTTGCACAAGGATTTGGCTCCTTGGGGTTAATGACATCTGTGTTGATTACCCCGGACGGT AAAACCTTTGAAAGCGAAGCCGCCCACGGTACAGTAACAAGACATTTTAGACAGCATCAG CAAGGAAAGGAGACGTCAACAAATTCCATTGCATCAATTTTCGCGTGGACTAGAGGTATT ATTCAAAGGGGTAAACTTGATAATACTCCAGATGTAGTTAAGTTCGGCCAAATATTGGAA AGCGCTACGGTAAATACAGTGCAAGAAGATGGAATCATGACTAAAGATTTGGCGCTCATT CTCGGTAAGTCTGAAAGATCCGCTTATGTCACTACCGAGGAGTTCATTGACGCGGTGGAA TCTAGATTGAAAAAAGAGTTCGAGGCAGCTGCATTGTAA
Protein Properties
Pfam Domain Function
Protein Residues412
Protein Molecular Weight46561.89844
Protein Theoretical pI6.08
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isocitrate dehydrogenase [NADP] cytoplasmic MTKIKVANPIVEMDGDEQTRIIWHLIRDKLVLPYLDVDLKYYDLSVEYRDQTNDQVTVDS ATATLKYGVAVKCATITPDEARVEEFHLKKMWKSPNGTIRNILGGTVFREPIIIPRIPRL VPQWEKPIIIGRHAFGDQYKATDVIVPEEGELRLVYKSKSGTHDVDLKVFDYPEHGGVAM MMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFE SLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDG KTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILE SATVNTVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRLKKEFEAAAL
References
External Links
ResourceLink
Saccharomyces Genome Database IDP2
Uniprot IDP41939
Uniprot NameIDHC_YEAST
GenBank Gene IDU17246
Genebank Protein ID577204
General Reference
  • Loftus, T. M., Hall, L. V., Anderson, S. L., McAlister-Henn, L. (1994). "Isolation, characterization, and disruption of the yeast gene encoding cytosolic NADP-specific isocitrate dehydrogenase." Biochemistry 33:9661-9667.8068643
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106