You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThiamine biosynthetic bifunctional enzyme
Synonyms
  • Thiamine-phosphate pyrophosphorylase
  • TMP pyrophosphorylase
  • TMP-PPASE
  • Hydroxyethylthiazole kinase
  • 4-methyl-5-beta-hydroxyethylthiazole kinase
  • TH kinase
  • THZ kinase
Gene NameTHI6
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionEssential for thiamine biosynthesis. The kinase activity is involved in the salvage synthesis of TH-P from the thiazole
Cellular LocationNot Available
SMPDB Pathways
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Thiamine metabolismec00730 Map00730
SMPDB Reactions
4-amino-2-methyl-5-diphosphomethylpyrimidine + hydron + 4-methyl-5-(2-phosphonooxyethyl)thiazole → Pyrophosphate + Thiamine monophosphate
5-(2-Hydroxyethyl)-4-methylthiazole + Adenosine triphosphate → 4-methyl-5-(2-phosphonooxyethyl)thiazole + hydron + ADP
KEGG Reactions
Adenosine triphosphate + 5-(2-Hydroxyethyl)-4-methylthiazole4-Methyl-5-(2-phosphonooxyethyl)thiazole + hydron + ADP
4-Methyl-5-(2-phosphonooxyethyl)thiazole + hydron + 4-amino-2-methyl-5-diphosphomethylpyrimidinePyrophosphate + Thiamine monophosphate
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB001174-amino-2-methyl-5-diphosphomethylpyrimidineShow
YMDB00164Thiamine monophosphateShow
YMDB00219PyrophosphateShow
YMDB003194-Methyl-5-(2-phosphonooxyethyl)thiazoleShow
YMDB007065-(2-Hydroxyethyl)-4-methylthiazoleShow
YMDB00774Thiamine(1+) monophosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
thiamin-phosphate diphosphorylase activity
hydroxyethylthiazole kinase activity
catalytic activity
Process
metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
thiamin and derivative metabolic process
thiamin metabolic process
thiamin biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL214C
Gene Sequence>1623 bp ATGGTATTTACTAAGGAAGAAGTTGATTACTCATTATATCTGGTTACAGATTCTACCATG CTTCCACCGGGAACTACTTTATGTTCTCAGGTTGAAGCTGGGTTGAAAAATGGTGTAACG CTAGTTCAAATCCGTGAAAAGGATATTGAAACAAAAAATTTCGTTGCAGAGGCTTTAGAA GTTCAAAAAATATGTAAGAAGTACAATGTTCCACTTATTATCAATGACCGTATAGACGTC GCTATGGCAATTGACGCCGATGGGGTTCATGTGGGCCAGGACGATATGCCAATCCCAATG GTAAGAAAACTTTTGGGCCCTTCTAAAATTCTTGGATGGAGTGTTGGTAAACCTTCGGAG GTAGAGACATTGGCTAAATGGGGGCCAGATATGGTAGATTATATTGGTGTTGGTACTCTT TTCCCTACATCAACAAAGAAAAATCCTAAGAAATCACCCATGGGTCCTCAAGGCGCCATT GCCATTTTGGATGCTTTGGAGGAATTTAAAGCTACATGGTGTAGAACCGTTGGTATTGGT GGTCTTCATCCTGACAATATTCAACGTGTGCTTTGTCAATGTGTTGCTTCAAATGGAAAG AGATCGTTGGATGGTATCTCTCTAGTCAGCGATATTATGGCCGCTCCAGATGCATGTGCA GCAACCAAGAGGTTGAGAGGCTTGTTAGATGCTACCAGATACCAATTTGTTGAGTGCGAG TTAAATAATACATTTCCGACCACAACTTCAATTCAAAACGTTATATCTCAAGTATCAAAC AATCGTCCATTAGTGCAACATATCACCAATAAGGTTCATCAAAATTTTGGTGCCAATGTC ACTCTAGCTTTAGGCTCATCTCCTATCATGTCTGAAATTGAAAGTGAAGTATCTGAACTA GCAAGAATCCCAAATGCTTCTTTACTGTTAAATACCGGATCAGTGGCACCTATTGAAATG CTAAAAGCCGCAATTAATGCTTATAATGAAGTAAATAGACCCATCACCTTTGACCCGGTC GGGTACAGCGCCACTGAAACAAGGCTCTGTCTAAACAACACTTTGCTCACTTACGGCCAA TTTGCTTGTATAAAGGGCAATTGCAGTGAAATACTGTCTCTAGCCAAGTTAAATAACCAT AAAATGAAGGGCGTCGACTCTAGCAGCGGCAAAACGAACATCGACACACTTGTGCGCGCT ACACAAATTGTGGCATTCCAATACAGGACTGTTGCTGTTTGCACGGGTGAGTTTGATTGC GTTGCTGATGGTACTTTTGGAGGCGAATACAAACTTTCATCAGGAACAGAAGGAATAACC GCTGAAGATCTTCCATGTGTAATAATTGAAGATGGCCCAATTCCTATCATGGGTGACATC ACTGCAAGTGGATGTTCACTTGGTTCTACAATTGCTTCCTTTATCGGTGGGTTAGATTCC ACTGGAAAACTGTTTGATGCTGTGGTTGGTGCTGTCCTATTATACAAATCAGCTGGTAAG TTGGCTTCCACCCGTTGTCAAGGAAGTGGTTCATTCCATGTCGAATTGATTGACGCATTA TATCAATTATTCCATGAAAATAAACCAGAAAAGTGGTCCGCTTCTTTGAAGAAATTCAAA TAA
Protein Properties
Pfam Domain Function
Protein Residues540
Protein Molecular Weight58058.19922
Protein Theoretical pI5.74
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Thiamine biosynthetic bifunctional enzyme MVFTKEEVDYSLYLVTDSTMLPPGTTLCSQVEAGLKNGVTLVQIREKDIETKNFVAEALE VQKICKKYNVPLIINDRIDVAMAIDADGVHVGQDDMPIPMVRKLLGPSKILGWSVGKPSE VETLAKWGPDMVDYIGVGTLFPTSTKKNPKKSPMGPQGAIAILDALEEFKATWCRTVGIG GLHPDNIQRVLCQCVASNGKRSLDGISLVSDIMAAPDACAATKRLRGLLDATRYQFVECE LNNTFPTTTSIQNVISQVSNNRPLVQHITNKVHQNFGANVTLALGSSPIMSEIESEVSEL ARIPNASLLLNTGSVAPIEMLKAAINAYNEVNRPITFDPVGYSATETRLCLNNTLLTYGQ FACIKGNCSEILSLAKLNNHKMKGVDSSSGKTNIDTLVRATQIVAFQYRTVAVCTGEFDC VADGTFGGEYKLSSGTEGITAEDLPCVIIEDGPIPIMGDITASGCSLGSTIASFIGGLDS TGKLFDAVVGAVLLYKSAGKLASTRCQGSGSFHVELIDALYQLFHENKPEKWSASLKKFK
References
External Links
ResourceLink
Saccharomyces Genome Database THI6
Uniprot IDP41835
Uniprot NameTHI6_YEAST
GenBank Gene IDD31908
Genebank Protein ID633125
General Reference
  • Nosaka, K., Nishimura, H., Kawasaki, Y., Tsujihara, T., Iwashima, A. (1994). "Isolation and characterization of the THI6 gene encoding a bifunctional thiamin-phosphate pyrophosphorylase/hydroxyethylthiazole kinase from Saccharomyces cerevisiae." J Biol Chem 269:30510-30516.7982968
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875