You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMetal resistance protein YCF1
Synonyms
  • Yeast cadmium factor 1
Gene NameYCF1
Enzyme ClassNot Available
Biological Properties
General FunctionDefense mechanisms
Specific FunctionCooperates for the ATP-dependent vacuolar transport of bilirubin and glutathione conjugates
Cellular LocationVacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Glutathione + waterphosphate + Glutathione + hydron + ADP
Metabolites
YMDB IDNameView
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
binding
ATPase activity, coupled to transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
nucleoside-triphosphatase activity
ATPase activity
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
transporter activity
adenyl ribonucleotide binding
transmembrane transporter activity
ATP binding
nucleotide binding
hydrolase activity
active transmembrane transporter activity
primary active transmembrane transporter activity
P-P-bond-hydrolysis-driven transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>4548 bp ATGGCTGGTAATCTTGTTTCATGGGCCTGCAAGCTCTGTAGATCTCCTGAAGGGTTTGGA CCTATATCCTTTTACGGTGACTTTACTCAATGCTTCATCGACGGTGTGATCCTAAATCTA TCAGCAATTTTCATGATAACCTTCGGTATCAGAGATTTAGTTAACCTTTGCAAGAAAAAA CACTCTGGCATCAAATATAGGCGGAATTGGATTATTGTCTCTAGGATGGCACTAGTTCTG TTGGAGATAGCGTTTGTTTCACTTGCGTCTTTAAATATTTCTAAAGAAGAAGCGGAAAAC TTTACCATTGTAAGTCAATATGCTTCTACAATGTTATCTTTATTTGTTGCTTTAGCCTTA CACTGGATAGAATACGATAGATCAGTTGTAGCCAATACGGTACTTTTATTCTATTGGCTT TTTGAAACATTCGGTAATTTTGCTAAACTAATAAATATTCTAATTAGACACACCTACGAA GGCATTTGGTATTCCGGACAAACGGGTTTCATACTAACGTTATTCCAAGTAATAACATGT GCCAGTATCCTGTTACTTGAAGCTCTTCCAAAGAAGCCGCTAATGCCACATCAACACATA CATCAAACTTTAACAAGAAGAAAACCAAATCCATACGATAGCGCAAACATATTTTCCAGG ATTACCTTCTCTTGGATGTCAGGTTTGATGAAAACTGGCTATGAAAAATACTTAGTGGAA GCAGATTTATATAAATTACCGAGGAACTTTAGTAGTGAAGAACTCTCTCAAAAATTGGAG AAAAACTGGGAAAATGAGTTGAAGCAAAAATCAAATCCTTCATTATCATGGGCTATATGC AGAACTTTTGGATCTAAAATGCTTTTAGCCGCATTCTTTAAAGCAATTCATGATGTTCTA GCATTTACTCAACCACAACTACTAAGGATTTTAATCAAGTTCGTCACAGACTATAACAGT GAGAGACAGGATGACCATTCTTCTCTTCAAGGGTTTGAAAATAACCACCCACAAAAATTA CCCATTGTAAGAGGGTTTTTGATTGCGTTTGCTATGTTTCTGGTGGGCTTTACTCAGACA TCTGTCCTGCATCAATATTTCCTGAATGTCTTCAACACAGGCATGTATATTAAGAGCGCC CTAACGGCTTTAATATATCAAAAATCCTTAGTGCTATCTAATGAGGCTTCTGGACTTTCC TCTACCGGTGACATTGTCAATCTCATGAGTGTGGATGTTCAAAAATTACAAGATTTAACA CAATGGCTAAATTTAATATGGTCAGGGCCTTTTCAAATCATTATTTGCTTATATTCTCTG TATAAGTTGTTGGGAAATTCCATGTGGGTTGGCGTGATTATACTAGTTATTATGATGCCA TTGAACTCATTTTTGATGAGGATACAAAAGAAGTTGCAAAAATCCCAGATGAAGTACAAA GATGAAAGGACCCGTGTTATAAGTGAAATACTAAACAATATTAAATCTTTGAAGTTATAT GCATGGGAGAAGCCTTATAGGGAAAAGCTAGAAGAAGTAAGAAATAACAAAGAGTTAAAA AATCTTACAAAACTAGGATGTTATATGGCTGTGACAAGTTTTCAGTTCAATATAGTACCA TTCCTTGTTTCATGTTGTACCTTTGCTGTATTTGTTTATACTGAGGATAGAGCATTGACT ACTGACTTAGTTTTCCCTGCTTTGACTCTGTTCAACCTGCTCTCATTCCCACTAATGATT ATTCCTATGGTTTTAAATTCTTTTATCGAAGCTTCTGTTTCTATTGGTAGATTATTTACA TTCTTTACCAATGAAGAGCTACAACCAGATTCGGTTCAGCGTTTACCAAAAGTAAAAAAT ATTGGCGATGTAGCCATTAACATTGGAGATGATGCTACCTTTTTATGGCAACGGAAACCG GAATACAAAGTAGCCTTAAAGAATATTAATTTCCAAGCTAAAAAAGGAAATTTGACCTGT ATTGTTGGTAAAGTTGGCAGTGGTAAAACAGCTCTATTGTCATGCATGTTAGGTGATCGA TTCAGGGTTAAAGGTTTCGCCACCGTTCATGGTTCTGTTGCTTATGTTTCACAAGTTCCA TGGATAATGAATGGTACTGTAAAGGAAAACATTTTATTTGGGCATAGATACGACGCGGAA TTTTACGAAAAAACGATCAAGGCCTGTGCGTTAACTATTGATCTTGCAATTTTGATGGAT GGAGATAAGACATTAGTTGGCGAGAAAGGGATCTCCTTATCTGGAGGACAAAAAGCTCGT TTGTCTTTAGCAAGAGCAGTTTATGCGAGAGCTGACACTTATTTACTTGATGATCCTTTG GCAGCTGTTGATGAACACGTTGCCAGGCACTTGATCGAACATGTGTTGGGTCCAAATGGT TTATTACATACAAAAACGAAGGTATTAGCCACTAATAAGGTGAGCGCGTTATCCATCGCA GATTCTATTGCATTATTAGATAATGGAGAAATCACACAGCAGGGTACATATGATGAGATT ACGAAGGACGCTGATTCGCCATTATGGAAATTGCTCAACAACTATGGTAAAAAAAATAAC GGTAAGTCGAATGAATTCGGTGACTCCTCTGAAAGCTCAGTTCGAGAAAGTAGTATACCT GTAGAAGGAGAGCTGGAACAACTGCAGAAATTAAATGATTTGGATTTTGGCAACTCTGAC GCCATAAGTTTAAGGAGGGCCAGTGATGCAACTTTGGGAAGCATCGATTTTGGTGACGAT GAAAATATTGCTAAAAGAGAGCATCGTGAACAGGGAAAAGTAAAGTGGAACATTTACCTA GAGTACGCTAAAGCTTGCAACCCGAAAAGCGTTTGTGTATTCATATTGTTTATTGTTATA TCGATGTTCCTCTCTGTTATGGGTAACGTTTGGTTGAAACATTGGTCTGAAGTTAATAGC CGCTATGGATCTAATCCAAATGCCGCGCGTTACTTGGCCATTTATTTTGCACTTGGTATT GGTTCAGCACTGGCAACATTAATCCAGACAATCGTTCTCTGGGTTTTTTGTACCATTCAT GCCTCCAAATATTTACACAACTTGATGACAAACTCTGTGTTGAGAGCCCCAATGACGTTT TTTGAAACAACACCAATCGGTAGAATTCTAAACAGATTCTCAAATGACATATACAAAGTG GATGCTTTATTAGGAAGAACATTTTCTCAGTTTTTCGTCAATGCAGTGAAAGTCACATTC ACTATTACGGTTATCTGTGCGACGACATGGCAATTTATCTTCATTATCATTCCACTAAGT GTGTTTTACATCTACTACCAGCAGTATTACCTGAGAACATCAAGGGAGTTGCGTCGTTTA GACTCTATTACTAGGTCTCCAATCTACTCTCATTTCCAAGAGACTTTGGGTGGCCTTGCA ACGGTTAGAGGTTATTCTCAACAGAAAAGGTTTTCCCACATTAATCAATGCCGCATTGAT AATAACATGAGTGCGTTCTATCCCTCTATCAATGCTAACCGTTGGCTAGCATATAGGTTG GAACTTATTGGTTCAATTATCATTCTAGGTGCTGCAACTTTATCCGTTTTTAGACTAAAA CAAGGCACATTAACGGCAGGTATGGTGGGTTTATCATTAAGCTATGCTTTACAAATCACT CAAACGTTAAATTGGATTGTTAGAATGACTGTGGAAGTTGAAACGAATATTGTTTCAGTG GAAAGAATAAAGGAATATGCTGATTTGAAGAGCGAGGCACCTTTAATAGTTGAAGGCCAC AGACCACCCAAAGAATGGCCGAGCCAGGGTGATATAAAGTTTAATAATTATTCCACTCGT TATAGGCCGGAGCTTGATCTTGTTCTGAAGCACATTAATATACACATTAAACCAAATGAA AAAGTTGGTATCGTGGGTAGAACGGGTGCGGGAAAATCCTCATTAACGCTAGCATTATTC AGGATGATTGAGGCTAGCGAGGGAAACATCGTAATCGACAACATTGCCATCAACGAGATT GGGTTATATGATTTGAGACATAAATTGTCAATCATACCTCAGGATTCTCAAGTTTTTGAG GGCACTGTTCGTGAGAACATTGATCCCATTAACCAATACACTGATGAAGCTATTTGGAGG GCATTGGAACTTTCTCATTTGAAAGAACACGTGCTATCAATGAGCAATGACGGATTAGAT GCCCAACTAACCGAAGGTGGTGGCAACTTAAGTGTTGGACAAAGACAATTATTATGTCTT GCAAGAGCAATGTTGGTTCCATCAAAGATTTTGGTGCTTGATGAAGCCACGGCCGCAGTC GACGTGGAGACAGATAAAGTCGTCCAAGAGACGATTCGTACTGCTTTCAAGGACAGAACT ATCTTGACCATCGCGCATAGACTGAACACGATAATGGACAGTGATAGAATCATAGTGTTG GACAATGGTAAAGTAGCCGAGTTTGACTCTCCGGGCCAGTTATTAAGTGATAACAAATCA TTGTTCTATTCACTGTGCATGGAGGCTGGTTTGGTCAATGAAAATTAA
Protein Properties
Pfam Domain Function
Protein Residues1515
Protein Molecular Weight171120.0
Protein Theoretical pI8.57
Signalling Regions
  • None
Transmembrane Regions
  • 33-53
  • 74-94
  • 100-120
  • 131-151
  • 170-190
  • 279-299
  • 346-366
  • 423-443
  • 447-467
  • 531-551
  • 573-593
  • 944-964
  • 1002-1023
  • 1067-1087
  • 1089-1109
  • 1181-1201
  • 1206-1226
Protein Sequence>Metal resistance protein YCF1 MAGNLVSWACKLCRSPEGFGPISFYGDFTQCFIDGVILNLSAIFMITFGIRDLVNLCKKK HSGIKYRRNWIIVSRMALVLLEIAFVSLASLNISKEEAENFTIVSQYASTMLSLFVALAL HWIEYDRSVVANTVLLFYWLFETFGNFAKLINILIRHTYEGIWYSGQTGFILTLFQVITC ASILLLEALPKKPLMPHQHIHQTLTRRKPNPYDSANIFSRITFSWMSGLMKTGYEKYLVE ADLYKLPRNFSSEELSQKLEKNWENELKQKSNPSLSWAICRTFGSKMLLAAFFKAIHDVL AFTQPQLLRILIKFVTDYNSERQDDHSSLQGFENNHPQKLPIVRGFLIAFAMFLVGFTQT SVLHQYFLNVFNTGMYIKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKLQDLT QWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYK DERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVP FLVSCCTFAVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFT FFTNEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTC IVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAE FYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPL AAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEI TKDADSPLWKLLNNYGKKNNGKSNEFGDSSESSVRESSIPVEGELEQLQKLNDLDFGNSD AISLRRASDATLGSIDFGDDENIAKREHREQGKVKWNIYLEYAKACNPKSVCVFILFIVI SMFLSVMGNVWLKHWSEVNSRYGSNPNAARYLAIYFALGIGSALATLIQTIVLWVFCTIH ASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTF TITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLA TVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLK QGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGH RPPKEWPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALF RMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWR ALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAV DVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKS LFYSLCMEAGLVNEN
References
External Links
ResourceLink
Saccharomyces Genome Database YCF1
Uniprot IDP39109
Uniprot NameYCFI_YEAST
GenBank Gene IDL35237
Genebank Protein ID556465
General Reference
  • Szczypka, M. S., Wemmie, J. A., Moye-Rowley, W. S., Thiele, D. J. (1994). "A yeast metal resistance protein similar to human cystic fibrosis transmembrane conductance regulator (CFTR) and multidrug resistance-associated protein." J Biol Chem 269:22853-22857.7521334
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Li, Z. S., Szczypka, M., Lu, Y. P., Thiele, D. J., Rea, P. A. (1996). "The yeast cadmium factor protein (YCF1) is a vacuolar glutathione S-conjugate pump." J Biol Chem 271:6509-6517.8626454
  • Petrovic, S., Pascolo, L., Gallo, R., Cupelli, F., Ostrow, J. D., Goffeau, A., Tiribelli, C., Bruschi, C. V. (2000). "The products of YCF1 and YLL015w (BPT1) cooperate for the ATP-dependent vacuolar transport of unconjugated bilirubin in Saccharomyces cerevisiae." Yeast 16:561-571.10790694
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956