You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHigh-affinity hexose transporter HXT7
SynonymsNot Available
Gene NameHXT7
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionHigh-affinity glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 4
LocusYDR342C
Gene Sequence>1713 bp ATGTCACAAGACGCTGCTATTGCAGAGCAAACTCCTGTGGAGCATCTCTCTGCTGTTGAC TCAGCCTCCCACTCGGTTTTATCTACACCATCAAACAAGGCTGAAAGAGATGAAATAAAA GCTTATGGTGAAGGTGAAGAGCACGAACCTGTCGTTGAAATTCCAAAGAGACCAGCTTCT GCCTATGTCACTGTCTCTATTATGTGTATCATGATCGCCTTTGGTGGTTTCGTTTTCGGT TGGGATACTGGTACCATTTCTGGTTTCATCAATCAAACCGATTTCATCAGAAGATTTGGT ATGAAGCATAAAGATGGTACTAATTATTTGTCTAAGGTTAGAACTGGTTTGATTGTCTCC ATTTTCAACATTGGTTGTGCCATTGGTGGTATTATTCTTTCCAAATTGGGTGATATGTAC GGTCGTAAGGTGGGTTTGATTGTCGTTGTTGTCATCTACATCATCGGTATTATTATTCAA ATTGCATCTATCAACAAATGGTACCAATATTTCATCGGTAGAATTATTTCCGGTTTGGGT GTTGGTGGTATTGCCGTTTTATCTCCTATGTTGATTTCTGAAGTATCCCCAAAGCATTTA AGGGGTACTTTAGTCTCTTGCTACCAATTGATGATTACTGCCGGTATTTTCTTGGGTTAC TGTACCAACTTCGGTACTAAGAACTACTCCAACTCTGTGCAATGGAGAGTTCCATTAGGT TTGTGTTTTGCCTGGGCTTTGTTTATGATTGGTGGTATGACATTTGTTCCAGAGTCTCCA CGTTATTTGGCTGAAGTCGGTAAGATCGAAGAAGCCAAACGTTCTATTGCCGTTTCTAAC AAGGTTGCTGTTGATGATCCATCTGTTTTGGCTGAAGTCGAAGCTGTCTTGGCTGGTGTA GAGGCAGAGAAATTAGCTGGTAATGCATCCTGGGGTGAATTGTTTAGTAGCAAGACAAAG GTCCTTCAGCGTTTGATCATGGGTGCTATGATTCAATCTCTACAACAATTGACAGGTGAT AACTATTTCTTCTACTATGGTACTACTATTTTCAAGGCTGTTGGTTTGAGTGACTCTTTC GAAACCTCTATTGTCTTGGGTATTGTTAACTTTGCTTCCACCTTTGTTGGTATTTACGTT GTTGAGAGATATGGTCGTCGTACTTGTTTGCTATGGGGTGCTGCATCCATGACTGCTTGT ATGGTTGTCTATGCTTCCGTGGGTGTCACCAGATTATGGCCAAATGGTCAAGACCAACCA TCTTCCAAGGGTGCTGGTAACTGTATGATTGTCTTTGCCTGTTTCTATATTTTCTGTTTT GCTACTACATGGGCTCCAATTCCTTATGTCGTTGTTTCTGAAACTTTCCCATTGAGAGTC AAGTCTAAGGCTATGTCTATTGCTACAGCTGCTAATTGGTTGTGGGGTTTCTTGATTGGT TTCTTCACTCCATTTATTACTGGTGCTATTAACTTCTACTACGGTTACGTTTTCATGGGC TGTTTGGTCTTCATGTTCTTCTATGTTTTGTTAGTTGTTCCAGAAACTAAGGGTTTGACT TTGGAAGAAGTCAACACCATGTGGGAAGAAGGTGTTCTACCATGGAAGTCTGCCTCATGG GTTCCACCATCCAGAAGAGGTGCCAACTACGACGCTGAAGAAATGACTCACGATGACAAG CCATTGTACAAGAGAATGTTCAGCACCAAATAA
Protein Properties
Pfam Domain Function
Protein Residues570
Protein Molecular Weight62734.60156
Protein Theoretical pI7.84
Signalling Regions
  • None
Transmembrane Regions
  • 61-81
  • 117-137
  • 144-164
  • 175-195
  • 202-222
  • 237-257
  • 341-357
  • 364-381
  • 389-409
  • 432-452
  • 470-490
  • 492-512
Protein Sequence>High-affinity hexose transporter HXT6 MSQDAAIAEQTPVEHLSAVDSASHSVLSTPSNKAERDEIKAYGEGEEHEPVVEIPKRPAS AYVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVS IFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLG VGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLG LCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGV EAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSF ETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQP SSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIG FFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASW VPPSRRGANYDAEEMTHDDKPLYKRMFSTK
References
External Links
ResourceLink
Saccharomyces Genome Database HXT7
Uniprot IDP39004
Uniprot NameHXT7_YEAST
GenBank Gene IDU51032
Genebank Protein ID1230669
General Reference
  • Reifenberger, E., Freidel, K., Ciriacy, M. (1995). "Identification of novel HXT genes in Saccharomyces cerevisiae reveals the impact of individual hexose transporters on glycolytic flux." Mol Microbiol 16:157-167.7651133
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956