Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSaccharopine dehydrogenase [NADP+, L-glutamate-forming]
Synonyms
  • Saccharopine reductase
Gene NameLYS9
Enzyme Class
Biological Properties
General FunctionInvolved in binding
Specific FunctionN(6)-(L-1,3-dicarboxypropyl)-L-lysine + NADP(+) + H(2)O = L-glutamate + L-2-aminoadipate 6-semialdehyde + NADPH
Cellular LocationNot Available
SMPDB Pathways
lysine metabolismPW002420 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lysine biosynthesisec00300 Map00300
Lysine degradationec00310 Map00310
SMPDB Reactions
Allysine + NADPH + L-Glutamic acid + hydronwater + NADP + Saccharopine
KEGG Reactions
L-Allysine + L-Glutamic acid + NADPH + hydronNADP + water + Saccharopine
Metabolites
YMDB IDNameView
YMDB00019SaccharopineShow
YMDB00271L-Glutamic acidShow
YMDB00346AllysineShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00721L-AllysineShow
YMDB00862hydronShow
YMDB00890waterShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 14
LocusYNR050C
Gene Sequence>1341 bp ATGGGAAAGAACGTTTTGTTGCTAGGATCTGGTTTTGTTGCACAACCTGTTATCGACACA TTGGCTGCTAATGATGACATCAATGTCACTGTCGCATGTAGAACATTAGCCAATGCGCAA GCATTGGCCAAGCCCTCTGGATCCAAGGCTATTTCATTGGATGTTACCGATGACAGTGCC TTAGACAAAGTTCTGGCTGATAACGATGTTGTCATCTCTTTGATTCCATACACCTTCCAT CCAAATGTGGTAAAGAGCGCCATCAGAACAAAGACCGATGTCGTCACTTCCTCTTACATC TCACCTGCCTTAAGAGAATTGGAACCAGAAATCGTAAAGGCAGGTATTACAGTTATGAAC GAAATTGGGTTGGATCCAGGTATCGACCACTTGTATGCGGTCAAGACTATTGATGAAGTT CACAGAGCTGGTGGTAAGCTAAAGTCATTCTTGTCATACTGTGGTGGTTTACCAGCTCCT GAAGACTCTGATAATCCATTAGGATACAAATTTTCATGGTCCTCCAGAGGTGTGCTACTG GCTTTAAGAAACTCTGCTAAATACTGGAAAGACGGAAAGATTGAAACTGTTTCTTCCGAA GACTTAATGGCCACTGCTAAGCCTTACTTCATCTACCCAGGTTATGCATTCGTTTGCTAC CCAAATAGAGACTCTACCCTTTTCAAGGATCTTTATCATATTCCAGAAGCCGAAACGGTC ATTAGAGGTACTTTGAGATATCAAGGTTTCCCAGAATTTGTTAAGGCTTTAGTTGACATG GGTATGTTGAAGGATGATGCTAACGAAATCTTCAGCAAGCCAATTGCCTGGAACGAAGCA CTAAAACAATATTTAGGTGCCAAGTCTACTTCTAAAGAAGATTTGATTGCTTCCATTGAC TCAAAGGCTACTTGGAAAGATGATGAAGATAGAGAAAGAATCCTTTCCGGGTTTGCTTGG TTAGGCTTGTTCTCTGACGCAAAGATCACACCAAGAGGTAATGCTTTAGACACTCTATGT GCACGTTTAGAAGAACTAATGCAATATGAAGACAATGAAAGAGATATGGTTGTACTACAA CACAAATTCGGTATTGAATGGGCTGATGGAACTACCGAAACAAGAACATCCACTTTAGTT GACTATGGTAAGGTTGGTGGTTACAGTTCTATGGCCGCTACTGTTGGTTATCCAGTTGCC ATTGCAACGAAATTCGTCTTAGATGGTACAATCAAGGGACCAGGCTTACTAGCGCCATAC TCACCAGAGATTAATGATCCAATCATGAAAGAACTAAAGGACAAGTACGGCATCTATCTA AAGGAAAAGACAGTGGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues446
Protein Molecular Weight48917.30078
Protein Theoretical pI4.87
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Saccharopine dehydrogenase [NADP+, L-glutamate-forming] MGKNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKPSGSKAISLDVTDDSA LDKVLADNDVVISLIPYTFHPNVVKSAIRTKTDVVTSSYISPALRELEPEIVKAGITVMN EIGLDPGIDHLYAVKTIDEVHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSRGVLL ALRNSAKYWKDGKIETVSSEDLMATAKPYFIYPGYAFVCYPNRDSTLFKDLYHIPEAETV IRGTLRYQGFPEFVKALVDMGMLKDDANEIFSKPIAWNEALKQYLGAKSTSKEDLIASID SKATWKDDEDRERILSGFAWLGLFSDAKITPRGNALDTLCARLEELMQYEDNERDMVVLQ HKFGIEWADGTTETRTSTLVDYGKVGGYSSMAATVGYPVAIATKFVLDGTIKGPGLLAPY SPEINDPIMKELKDKYGIYLKEKTVA
References
External Links
ResourceLink
Saccharomyces Genome Database LYS9
Uniprot IDP38999
Uniprot NameLYS9_YEAST
GenBank Gene IDX77363
Genebank Protein ID453186
General Reference
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Purushothaman, S. K., Bujnicki, J. M., Grosjean, H., Lapeyre, B. (2005). "Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA." Mol Cell Biol 25:4359-4370.15899842