You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTryptophan permease
Synonyms
  • Tryptophan amino acid transporter
Gene NameTAT2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionRequired for high-affinity tryptophan transport. Also transports cysteine, phenyalanine and tyrosine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00046L-CysteineShow
YMDB00126L-TryptophanShow
YMDB00154L-AlanineShow
YMDB00304L-PhenylalanineShow
YMDB00364L-TyrosineShow
YMDB00862hydronShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
catalytic activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOL020W
Gene Sequence>1779 bp ATGACCGAAGACTTTATTTCTTCTGTCAAGCGTTCAAATGAGGAGCTGAAGGAGCGAAAA TCTAACTTTGGATTTGTAGAATACAAATCCAAGCAATTAACATCATCCTCATCACACAAT TCAAACTCATCGCATCACGATGATGACAACCAACACGGCAAGAGGAATATTTTCCAGCGA TGTGTTGATTCTTTCAAGTCTCCTCTGGACGGCTCGTTCGACACAAGTAATTTGAAGAGG ACTCTGAAACCAAGGCACTTAATCATGATTGCCATTGGGGGCAGTATAGGTACTGGTTTG TTTGTCGGTAGTGGTAAGGCAATCGCCGAAGGTGGTCCTCTTGGTGTCGTCATTGGTTGG GCTATTGCAGGCTCTCAAATCATCGGGACGATTCATGGGCTAGGTGAAATCACGGTGCGG TTCCCCGTTGTCGGGGCCTTTGCCAATTACGGCACAAGGTTTTTGGATCCAAGTATAAGT TTTGTTGTTTCGACCATATACGTGCTACAGTGGTTTTTTGTATTACCCTTAGAAATCATT GCGGCGGCAATGACCGTAACGTACTGGAACTCGTCTATTGACCCCGTAATTTGGGTAGCC ATCTTTTATGCTGTTATTGTTTCCATAAATTTGTTTGGTGTACGAGGTTTTGGGGAAGCG GAATTTGCATTTTCCACCATAAAAGCAATAACAGTTTGCGGATTCATTATATTGTGCGTT GTCCTCATTTGCGGTGGAGGTCCCGACCACGAGTTCATTGGCGCCAAATACTGGCACGAC CCTGGTTGTTTGGCCAATGGGTTCCCGGGCGTTCTATCTGTTCTTGTTGTTGCTTCGTAT TCTCTCGGTGGTATAGAAATGACGTGCCTGGCATCAGGTGAAACGGACCCCAAAGGCTTA CCAAGTGCTATCAAGCAAGTGTTTTGGAGGATCTTATTTTTCTTTTTGATATCACTGACC CTGGTAGGATTCCTGGTTCCATATACAAACCAAAACTTACTGGGTGGTTCATCTGTGGAC AACTCACCTTTTGTCATTGCCATAAAATTGCATCACATTAAAGCCTTGCCCTCCATCGTC AATGCGGTCATCCTTATCAGTGTTTTGAGTGTAGGTAACTCCTGCATCTTCGCTTCAAGT AGAACGTTGTGTTCGATGGCCCACCAAGGCCTTATTCCATGGTGGTTTGGTTATATCGAC CGTGCTGGTAGGCCGCTGGTTGGCATTATGGCAAATTCACTATTTGGATTACTAGCATTT CTGGTCAAATCTGGCTCGATGTCTGAAGTTTTCAATTGGTTAATGGCCATTGCCGGCCTG GCCACGTGCATTGTCTGGTTGAGCATCAACCTGTCACATATCAGATTTAGACTGGCGATG AAGGCTCAAGGGAAGTCTCTGGATGAATTAGAATTTGTTAGTGCTGTCGGGATTTGGGGA TCAGCGTATTCCGCTTTAATCAACTGTCTAATCTTGATAGCTCAATTCTATTGTTCACTA TGGCCCATTGGTGGCTGGACCAGCGGCAAAGAAAGGGCTAAAATATTTTTTCAAAATTAT CTGTGTGCCTTAATCATGTTATTTATATTCATCGTCCACAAAATTTATTACAAGTGTCAA ACAGGCAAATGGTGGGGGGTTAAGGCGTTAAAGGACATAGATTTGGAAACCGATCGTAAA GATATCGACATCGAAATAGTCAAGCAAGAAATTGCCGAAAAGAAAATGTACCTAGATTCC CGTCCATGGTACGTGAGACAGTTCCATTTCTGGTGTTAA
Protein Properties
Pfam Domain Function
Protein Residues592
Protein Molecular Weight65403.80078
Protein Theoretical pI8.42
Signalling Regions
  • None
Transmembrane Regions
  • 88-108
  • 114-134
  • 161-181
  • 193-213
  • 227-247
  • 267-287
  • 307-327
  • 359-379
  • 405-425
  • 429-449
  • 473-493
  • 515-535
Protein Sequence>Tryptophan permease MTEDFISSVKRSNEELKERKSNFGFVEYKSKQLTSSSSHNSNSSHHDDDNQHGKRNIFQR CVDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGW AIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEII AAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCV VLICGGGPDHEFIGAKYWHDPGCLANGFPGVLSVLVVASYSLGGIEMTCLASGETDPKGL PSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNSPFVIAIKLHHIKALPSIV NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF LVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG SAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQ TGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLDSRPWYVRQFHFWC
References
External Links
ResourceLink
Saccharomyces Genome Database TAT2
Uniprot IDP38967
Uniprot NameTAT2_YEAST
GenBank Gene IDD16304
Genebank Protein ID1113091
General Reference
  • Schmidt, A., Hall, M. N., Koller, A. (1994). "Two FK506 resistance-conferring genes in Saccharomyces cerevisiae, TAT1 and TAT2, encode amino acid permeases mediating tyrosine and tryptophan uptake." Mol Cell Biol 14:6597-6606.7523855
  • Chen, X. H., Xiao, Z., Fitzgerald-Hayes, M. (1994). "SCM2, a tryptophan permease in Saccharomyces cerevisiae, is important for cell growth." Mol Gen Genet 244:260-268.8058037
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258