Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFAD synthase
Synonyms
  • FAD pyrophosphorylase
  • FMN adenylyltransferase
  • Flavin adenine dinucleotide synthase
Gene NameFAD1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme
Cellular LocationCytoplasm
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
Adenosine triphosphate + Flavin MononucleotidePyrophosphate + FAD
KEGG Reactions
Flavin Mononucleotide + Adenosine triphosphate + hydronPyrophosphate + FAD
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00296FADShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL045C
Gene Sequence>921 bp ATGCAGTTGAGCAAGGCTGCTGAGATGTGTTATGAGATAACAAACTCTTACTTACACATA GACCAGAAATCTCAGATAATAGCAAGTACACAAGAAGCGATACGGTTGACAAGAAAATAC TTACTAAGTGAAATTTTTGTACGTTGGAGTCCACTGAATGGGGAAATATCATTCTCGTAC AACGGAGGAAAAGATTGCCAGGTATTACTACTGTTATATCTGAGTTGCTTATGGGAATAT TTCTTCATTAAGGCTCAAAATTCCCAATTCGATTTCGAGTTTCAAAGCTTCCCCATGCAA AGACTTCCAACTGTTTTCATTGATCAAGAAGAAACTTTCCCTACATTAGAGAATTTTGTA CTGGAAACCTCAGAGCGATATTGCCTTTCCTTATACGAATCACAAAGGCAATCTGGTGCA TCGGTCAATATGGCAGACGCATTTAGAGATTTTATAAAGATATACCCTGAGACCGAAGCT ATAGTGATAGGTATTAGACACACAGACCCATTTGGTGAAGCATTAAAGCCTATTCAAAGA ACAGATTCTAACTGGCCTGATTTTATGAGGTTGCAACCTCTCTTACACTGGGACTTAACC AATATATGGAGTTTCTTACTGTATTCTAATGAGCCAATTTGTGGACTATATGGTAAAGGT TTCACATCAATCGGCGGAATTAACAACTCATTGCCTAACCCACACTTGAGAAAGGACTCC AATAATCCAGCCTTGCATTTTGAATGGGAAATCATTCATGCATTTGGCAAGGACGCAGAA GGCGAACGTAGTTCCGCTATAAACACGTCACCTATTTCCGTGGTGGATAAGGAAAGATTC AGCAAATACCATGACAATTACTATCCTGGCTGGTATTTGGTTGATGACACTTTAGAGAGA GCAGGCAGGATCAAGAATTAA
Protein Properties
Pfam Domain Function
Protein Residues306
Protein Molecular Weight35545.80078
Protein Theoretical pI4.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>FAD synthase MQLSKAAEMCYEITNSYLHIDQKSQIIASTQEAIRLTRKYLLSEIFVRWSPLNGEISFSY NGGKDCQVLLLLYLSCLWEYFFIKAQNSQFDFEFQSFPMQRLPTVFIDQEETFPTLENFV LETSERYCLSLYESQRQSGASVNMADAFRDFIKIYPETEAIVIGIRHTDPFGEALKPIQR TDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPICGLYGKGFTSIGGINNSLPNPHLRKDS NNPALHFEWEIIHAFGKDAEGERSSAINTSPISVVDKERFSKYHDNYYPGWYLVDDTLER AGRIKN
References
External Links
ResourceLink
Saccharomyces Genome Database FAD1
Uniprot IDP38913
Uniprot NameFAD1_YEAST
GenBank Gene IDAY558157
Genebank Protein ID45270204
General Reference
  • Wu, M., Repetto, B., Glerum, D. M., Tzagoloff, A. (1995). "Cloning and characterization of FAD1, the structural gene for flavin adenine dinucleotide synthetase of Saccharomyces cerevisiae." Mol Cell Biol 15:264-271.7799934
  • Saren, A. M., Laamanen, P., Lejarcegui, J. B., Paulin, L. (1997). "The sequence of a 36.7 kb segment on the left arm of chromosome IV from Saccharomyces cerevisiae reveals 20 non-overlapping open reading frames (ORFs) including SIT4, FAD1, NAM1, RNA11, SIR2, NAT1, PRP9, ACT2 and MPS1 and 11 new ORFs." Yeast 13:65-71.9046088
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287