You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTrehalose synthase complex regulatory subunit TPS3
Synonyms
  • Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 115 kDa subunit
Gene NameTPS3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionRegulatory subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6- phosphate and UDP-glucose in a two step process. May stabilize the trehalose synthase complex
Cellular LocationCytoplasm
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Uridine diphosphate glucose + alpha-D-glucose 6 phosphateUridine 5'-diphosphate + Trehalose 6-phosphate
Trehalose 6-phosphate + waterTrehalose + phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00137Trehalose 6-phosphateShow
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB16263alpha-D-glucose 6 phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
trehalose metabolic process
trehalose biosynthetic process
metabolic process
primary metabolic process
carbohydrate metabolic process
oligosaccharide metabolic process
disaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR261C
Gene Sequence>3165 bp ATGACTATTATCGTCGCTTCTTTATTCTTACCATATACCCCTCAATTCGAGGCTGATGTC ACCAACTCGGATACTGCTAAGCTGGTTGAATCAAGTATGATCAAGGTAGACTGCAACAAC CAGGAATTGAGCAACAACAAGCAAGAAAGAAGCAGTTCTGTAACTTCGGCAAGCTCTCAT TATATTGGCTTACCTCAGGAGGCGCAAATTAACGGTGAACCCTTACAAAGGGCCAATGTG GGCTCTCCTGCTACGGGAGTTAACTATCATAATGAGATGGAAATGCTTTCCTCAGAGCAA TTCCTGGAAGAGCTGACTGCCAATGCCACTCATGCAGCAAACTCTGGTATTCCGCCAGCT AATAACCCAGTTTCTTCTGGCTCAACTGCCCAGCGGCCTTCAGTCGAGGAATTCTTTTCT GCTCCGTCTGCTAGAGTCTGTTCTCCCTCCCAGGAAGCTTCTGCTTCGTCTATTTCTGCT AGTCGTTCATCGGCTCACCACAACGATTTGAGCTCCAGCCTTATGAAAAATCCCAATTTG TCATTTGATTCACATCCACCCAGGGTCAGAAGCTCATCCAAGAGTGCTGTAATCACTCCC GTCTCTAAAAGCGTTCCAGATGTCGATCCTGCTGTTGTAGATGTCGCAAAAGTTAGAGAA GAGTTTCAACAGCAAGCCTCCTTGCCTTCCATGAAAAGAGTTTCCGGAAGCACCGCTGGA GACTCTTCCATTGCTTCTTCGAGTTCTAATCTCAGGTACTCACAGCAATTTCAGGATAAC TTTATCGAAGACACTGATAGTGAGGATGACATTGATTCTGATTTGGAGACCGATGCTACT AAGAAATACAACGTCCCAAAATTTGGTGGCTATTCCAATAACGCAAAGTTAAGAGCATCT CTAATGAGAAACTCGTATGAGCTATTCAAACATTTGCCATGGACAATAGTCGACAGTGAC AAAGGGAACGGATCCTTGAAAAATGCAGTTAATATTGCAGTTGCTGAAAAGACAGTGAAA GAACCTGTTTCCTGGGTAGGTACAATGGGAATCCCTACTGACGAACTTCCTCACGAAGTT TGCCATAAGATTTCAAAGAAATTAGAACAGGATTTTTCTTCTTTTCCAGTGGTCACGGAC GATATTACTTTTAAGGGTGCTTATAAGAACTACGCCAAACAGATTTTATGGCCCACTCTA CATTATCAAATTCCAGATAATCCAAATTCAAAGGCTTTTGAAGACCATTCTTGGGACTAC TATCAAAAAGTGAATCAAAAGTTTTCTGATAGGATAGTTTCCGTTTACAAACCTGGCGAC ACAATTTGGATCCATGATTATCATTTGATGCTTGTCCCACAAATGGTGAGAGAGAAACTG CCTAAAGCTAAGATTGGATTTTTCTTACACGTATCATTTCCAAGTAGTGAGGTCTTCAGA TGCCTTGCTAACAGAGAAAGGATTCTTGAAGGTATTATTGGTGCAAACTTTGTTGGGTTT CAAACTAAAGAATACAAAAGACATTTCCTACAAACTTGTAACAGATTGCTTGCTGCGGAT GTCTCTAATGATGAAGTCAAATACCATTGCAATATTGTTTCCGTGATGTATGCGCCAATT GGTATTGATTATTACCATTTGACATCGCAGTTGAGAAATGGTTCTGTACTTGAATGGCGC CAATTAATTAAAGAAAGATGGCGTAATAAAAAACTGATTGTTTGTCGCGATCAATTTGAC AGAATTAGAGGTCTTCAGAAAAAAATGTTAGCCTACGAGAGGTTTTTGATAGAAAACCCT GAATACATCGAAAAAGTTGTTTTGATCCAAATCTGCATCGGTAAGAGTTCCGATCCTGAG TACGAACGTCAAATTATGGTTGTCGTTGATAGAATCAATTCTTTGTCTTCGAACATCAGT ATCTCTCAACCAGTGGTCTTTTTGCATCAAGATTTAGATTTTGCTCAATATTTGGCATTG AATTGTGAAGCTGACGTTTTCCTTGTGGATGCGCTGAGAGAAGGTATGAATTTAACATGT CATGAGTTCATTGTCAGTTCATTCGAAAAAAATGCGCCTCTATTATTATCTGAATTCACT GGTAGTTCTTCTGTCCTAAAGGAAGGTGCCATCTTAATAAACCCATGGGATATAAATCAT GTAGCACAAAGTATCAAGAGAAGTTTAGAAATGTCTCCAGAAGAAAAAAGGCGTAGGTGG AAAAAATTATTCAAATCTGTTATTGAACATGATTCGGATAATTGGATTACAAAGTGCTTC GAATACATAAATAATGCTTGGGAGTCCAACCAAGAAACGTCTACTGTTTTCAATTTGGCT CCAGAAAAATTCTGTGCTGATTACAAAGCCTCCAAAAAGCATTTATTTATCTTCAAGATT TCAGAACCTCCAACGTCCAGAATGCTATCCTTGCTAAGTGAATTGAGTTCAAATAATATA GTTTACGTTTTGAGTTCATTTACAAAGAATACATTCGAAAGCTTATACAATGGTGTTCTA AACATCGGATTGATAGCGGAGAATGGTGCCTACGTAAGAGTTAATGGGTCGTGGTACAAC ATCGTGGAAGAGCTTGATTGGATGAAAGAGGTGGCAAAGATCTTTGACGAGAAAGTCGAG AGGTTACCTGGTTCATACTACAAAATCGCTGATTCTATGATCAGATTCCATACAGAAAAC GCTGATGATCAAGATCGAGTCCCAACTGTTATTGGGGAAGCCATTACGCACATAAACACC TTATTTGATGACAGGGATATTCACGCTTATGTGCATAAGGATATTGTCTTCGTTCAACAA ACGGGGCTAGCCTTAGCCGCCGCTGAGTTTTTGATGAAATTTTACAACAGTGGCGTCAGT CCTACTGACAATAGCAGAATATCTCTATCAAGAACATCCTCTTCGATGTCCGTCGGTAAT AATAAGAAGCATTTCCAAAACCAGGTAGATTTCGTTTGCGTTTCCGGTTCGACATCACCT ATTATTGAACCATTATTTAAATTAGTGAAGCAAGAGGTTGAAAAGAACAATCTAAAATTT GGTTACACCATTCTTTACGGTAGCTCAAGATCCACTTATGCCAAGGAACATATCAATGGT GTCAATGAACTTTTTACCATCCTTCATGACTTGACAGCCGCCTAA
Protein Properties
Pfam Domain Function
Protein Residues1054
Protein Molecular Weight118834.0
Protein Theoretical pI6.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Trehalose synthase complex regulatory subunit TPS3 MTIIVASLFLPYTPQFEADVTNSDTAKLVESSMIKVDCNNQELSNNKQERSSSVTSASSH YIGLPQEAQINGEPLQRANVGSPATGVNYHNEMEMLSSEQFLEELTANATHAANSGIPPA NNPVSSGSTAQRPSVEEFFSAPSARVCSPSQEASASSISASRSSAHHNDLSSSLMKNPNL SFDSHPPRVRSSSKSAVITPVSKSVPDVDPAVVDVAKVREEFQQQASLPSMKRVSGSTAG DSSIASSSSNLRYSQQFQDNFIEDTDSEDDIDSDLETDATKKYNVPKFGGYSNNAKLRAS LMRNSYELFKHLPWTIVDSDKGNGSLKNAVNIAVAEKTVKEPVSWVGTMGIPTDELPHEV CHKISKKLEQDFSSFPVVTDDITFKGAYKNYAKQILWPTLHYQIPDNPNSKAFEDHSWDY YQKVNQKFSDRIVSVYKPGDTIWIHDYHLMLVPQMVREKLPKAKIGFFLHVSFPSSEVFR CLANRERILEGIIGANFVGFQTKEYKRHFLQTCNRLLAADVSNDEVKYHCNIVSVMYAPI GIDYYHLTSQLRNGSVLEWRQLIKERWRNKKLIVCRDQFDRIRGLQKKMLAYERFLIENP EYIEKVVLIQICIGKSSDPEYERQIMVVVDRINSLSSNISISQPVVFLHQDLDFAQYLAL NCEADVFLVDALREGMNLTCHEFIVSSFEKNAPLLLSEFTGSSSVLKEGAILINPWDINH VAQSIKRSLEMSPEEKRRRWKKLFKSVIEHDSDNWITKCFEYINNAWESNQETSTVFNLA PEKFCADYKASKKHLFIFKISEPPTSRMLSLLSELSSNNIVYVLSSFTKNTFESLYNGVL NIGLIAENGAYVRVNGSWYNIVEELDWMKEVAKIFDEKVERLPGSYYKIADSMIRFHTEN ADDQDRVPTVIGEAITHINTLFDDRDIHAYVHKDIVFVQQTGLALAAAEFLMKFYNSGVS PTDNSRISLSRTSSSMSVGNNKKHFQNQVDFVCVSGSTSPIIEPLFKLVKQEVEKNNLKF GYTILYGSSRSTYAKEHINGVNELFTILHDLTAA
References
External Links
ResourceLink
Saccharomyces Genome Database TPS3
Uniprot IDP38426
Uniprot NameTPS3_YEAST
GenBank Gene IDAY692968
Genebank Protein ID51013387
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Reinders, A., Burckert, N., Hohmann, S., Thevelein, J. M., Boller, T., Wiemken, A., De Virgilio, C. (1997). "Structural analysis of the subunits of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae and their function during heat shock." Mol Microbiol 24:687-695.9194697
  • Bell, W., Sun, W., Hohmann, S., Wera, S., Reinders, A., De Virgilio, C., Wiemken, A., Thevelein, J. M. (1998). "Composition and functional analysis of the Saccharomyces cerevisiae trehalose synthase complex." J Biol Chem 273:33311-33319.9837904
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956