You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUridine permease
SynonymsNot Available
Gene NameFUI1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in nucleobase transmembrane transporter activity
Specific FunctionHigh-affinity transport of uridine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00127UridineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
nucleobase, nucleoside, nucleotide and nucleic acid transmembrane transporter activity
nucleobase transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
nucleobase, nucleoside, nucleotide and nucleic acid transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBL042C
Gene Sequence>1920 bp ATGCCGGTATCTGATTCTGGATTCGATAATTCTTCAAAAACAATGAAGGACGACACTATA CCGACGGAGGATTACGAAGAAATCACGAAAGAGTCCGAGATGGGTGATGCGACTAAAATT ACTTCTAAGATTGATGCTAATGTCATTGAAAAAAAAGATACCGATTCAGAAAACAATATA ACCATTGCTCAGGATGACGAAAAGGTGTCTTGGCTGCAAAGAGTTGTCGAGTTTTTTGAG GTTAAGAATGACTCTACCGATTTGGCCGATCATAAGCCCGAAAATCCAATTAGGACATTT AAAGATTTACAGGAGTCCCTCCGTTCGACGTACTTGTACAACACAGATCTGCGGCCCGTG GAGGCAAAAAGAAGAACGTGGACATGGAAGCAGTACATTTTCTTTTGGATTTCTGGGTCC TTTAACGTCAATACATGGCAAATCTCAGCCACTGGGCTACAGTTAGGGCTTAACTGGTGG CAGACTTGGATCTGTATTTGGGTTGGATACACGTTTGTCGCATTTTTCTTGATACTGGGT TCCAAAGTGGGGAACAATTACCATATCTCTTTCCCCATTTCCTCAAGAGTATCATTTGGT ATCTACTTCTCCATCTGGATTGTCATCAACCGTGTCGTCATGGCATGTGTCTGGAATTCT ACTTTGGCTTATATCGGTAGTCAATGTGTTCAGTTGATGCTAAAGGCTATCTTCGGTACT AATTTGAATACTAGAATCAAAGACACCATAAAGAACCCCAATTTGACGAACTTCGAGTTC ATGTGCTTCATGGTCTTCTGGGTCGCATGTTTACCGTTCCTATGGTTTCCACCTGACAAA TTGCGTCATATATTTGCACTCAAATCCGCCATCACTCCATTTGCGGCCTTCGGTTTTTTG ATTTGGACTCTTTGTAAGGCCAAAGGTCATTTGGCATTGGGTTCCCTAAATGACAATGGT GGCGCAATCAGCAAGACGGTTTTAGCATGGTCTGTCATTAGAGCTATTATGAGTGCTCTG GATAACTTCTCTACTTTAATCCTAAACGCTCCTGACTTCACTAGATTCGGTAAGACCTAC AAGTCATCTGTTTACTCGCAATTGATTGCGCTACCCGTCTGCTATGCCATTATTTCCTTA ATCGGAATATTGTCTGTCTCCGCAGCTTATACATTGTACGGAGTAAATTATTGGAGTCCC CTAGACATTCTGAACAGGTACTTGGATAACTATACTTCGGGGAACAGAGCCGGTGTATTC TTAATATCTTTCATTTTTGCGTTTGACCAGCTGGGTGCCAACTTGTCTGGTAACTCGATC CCTGCAGGTACCGATCTGACTGCATTATTGCCTAAATTCATCAATATCAGACGCGGTTCT TATATTTGTGCTCTAATATCGTTGGCGATTTGCCCCTGGGATTTATTATCATCATCGTCA AAGTTTACTACGGCACTAGCGGCATATGCAGTTTTCTTAAGTGCTATTGCGGGTGTAATA TCAGCCGATTACTTCATTGTCAGAAAGGGTTACGTTAATATTTTCCATTGCTACACCGAC AAGCCAGGATCGTACTACATGTACAATAAATATGGTACGAACTGGAGGGCGGTGGTAGCT TATATATTTGGTATTGCTCCTAATTTTGCAGGCTTTTTAGGTTCAGTGGGAGTTTCTGTG CCTATTGGCGCTATGAAAGTTTACTACCTAAACTATTTCGTTGGTTATCTCCTTGCAGCA TTGAGTTACTGCATTTTAGTGTATTTTTACCCAATTAAGGGTATTCCAGGCGATGCCAAG ATAACTGACCGTAAATGGCTCGAAGAGTGGGTCGAAGTAGAAGAATTCGGAACTGAAAGA GAAGCTTTTGAAGAATATGGCGGCGTTTCCACTGGCTATGAAAAGATACGATATATCTAA
Protein Properties
Pfam Domain Function
Protein Residues639
Protein Molecular Weight72164.39844
Protein Theoretical pI7.58
Signalling Regions
  • None
Transmembrane Regions
  • 163-180
  • 201-225
  • 260-276
  • 284-305
  • 368-392
  • 417-435
  • 461-477
  • 484-507
  • 538-562
  • 573-590
Protein Sequence>Uridine permease MPVSDSGFDNSSKTMKDDTIPTEDYEEITKESEMGDATKITSKIDANVIEKKDTDSENNI TIAQDDEKVSWLQRVVEFFEVKNDSTDLADHKPENPIRTFKDLQESLRSTYLYNTDLRPV EAKRRTWTWKQYIFFWISGSFNVNTWQISATGLQLGLNWWQTWICIWVGYTFVAFFLILG SKVGNNYHISFPISSRVSFGIYFSIWIVINRVVMACVWNSTLAYIGSQCVQLMLKAIFGT NLNTRIKDTIKNPNLTNFEFMCFMVFWVACLPFLWFPPDKLRHIFALKSAITPFAAFGFL IWTLCKAKGHLALGSLNDNGGAISKTVLAWSVIRAIMSALDNFSTLILNAPDFTRFGKTY KSSVYSQLIALPVCYAIISLIGILSVSAAYTLYGVNYWSPLDILNRYLDNYTSGNRAGVF LISFIFAFDQLGANLSGNSIPAGTDLTALLPKFINIRRGSYICALISLAICPWDLLSSSS KFTTALAAYAVFLSAIAGVISADYFIVRKGYVNIFHCYTDKPGSYYMYNKYGTNWRAVVA YIFGIAPNFAGFLGSVGVSVPIGAMKVYYLNYFVGYLLAALSYCILVYFYPIKGIPGDAK ITDRKWLEEWVEVEEFGTEREAFEEYGGVSTGYEKIRYI
References
External Links
ResourceLink
Saccharomyces Genome Database FUI1
Uniprot IDP38196
Uniprot NameFUI1_YEAST
GenBank Gene IDX78214
Genebank Protein ID872301
General Reference
  • De Wergifosse, P., Jacques, B., Jonniaux, J. L., Purnelle, B., Skala, J., Goffeau, A. (1994). "The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein." Yeast 10:1489-1496.7871888
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Wagner, R., de Montigny, J., de Wergifosse, P., Souciet, J. L., Potier, S. (1998). "The ORF YBL042 of Saccharomyces cerevisiae encodes a uridine permease." FEMS Microbiol Lett 159:69-75.9485596
  • Vickers, M. F., Yao, S. Y., Baldwin, S. A., Young, J. D., Cass, C. E. (2000). "Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes." J Biol Chem 275:25931-25938.10827169
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956