You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTricarboxylate transport protein
Synonyms
  • Citrate transport protein
  • CTP
Gene NameCTP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionTransport of citrate across inner mitochondrial membrane
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00086Citric acidShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB00280(S)-Malic acidShow
GO Classification
Component
mitochondrial inner membrane
cell part
membrane
organelle membrane
organelle inner membrane
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR291C
Gene Sequence>900 bp ATGTCCAGTAAAGCTACCAAAAGTGACGTAGATCCATTGCACTCGTTTCTGGCAGGGTCC CTAGCCGGTGCTGCTGAAGCATGTATAACATATCCTTTTGAATTTGCCAAAACAAGGCTG CAGCTGATTGATAAGGCCTCCAAGGCATCAAGAAATCCTCTGGTATTGATATATAAAACT GCAAAAACTCAGGGCATTGGTTCCATTTATGTCGGATGTCCCGCATTTATTATTGGTAAC ACCGCTAAGGCGGGTATTAGATTTCTTGGCTTTGATACCATTAAAGACTTGCTAAGAGAT AGGGAAACTGGAGAACTAAGTGGTACAAGAGGGGTGATAGCTGGGTTAGGTGCGGGACTA TTAGAAAGTGTTGCCGCAGTGACTCCTTTTGAAGCAATCAAAACTGCTTTGATCGATGAT AAACAATCTGCTACACCAAAATACCATAATAATGGGCGCGGTGTAGTACGAAACTATTCA TCATTAGTCCGTGATAAAGGATTTTCTGGTCTTTATCGTGGTGTTTTGCCAGTTTCCATG AGACAGGCCGCAAACCAAGCCGTTAGATTGGGTTGTTACAATAAGATTAAGACCTTGATC CAAGATTATACGGATTCGCCAAAAGACAAACCTTTATCATCCGGGTTAACCTTCTTAGTG GGTGCATTTAGTGGTATTGTGACGGTCTATTCCACCATGCCCCTTGATACTGTGAAAACA AGAATGCAAAGTTTGGATTCCACCAAATACTCCTCTACAATGAATTGTTTTGCAACCATT TTCAAAGAAGAAGGTTTAAAGACGTTTTGGAAAGGTGCTACGCCTAGACTTGGGAGATTG GTCTTGAGTGGTGGTATTGTTTTCACTATCTATGAAAAGGTCTTAGTTATGCTAGCCTGA
Protein Properties
Pfam Domain Function
Protein Residues299
Protein Molecular Weight32173.0
Protein Theoretical pI10.08
Signalling Regions
  • None
Transmembrane Regions
  • 16-36
  • 66-86
  • 113-133
  • 174-193
  • 215-235
  • 272-291
Protein Sequence>Tricarboxylate transport protein MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKT AKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGL LESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSM RQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKT RMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVMLA
References
External Links
ResourceLink
Saccharomyces Genome Database CTP1
Uniprot IDP38152
Uniprot NameTXTP_YEAST
GenBank Gene IDU17503
Genebank Protein ID642520
General Reference
  • Kaplan, R. S., Mayor, J. A., Gremse, D. A., Wood, D. O. (1995). "High level expression and characterization of the mitochondrial citrate transport protein from the yeast Saccharomyces cerevisiae." J Biol Chem 270:4108-4114.7876161
  • Holmstrom, K., Brandt, T., Kallesoe, T. (1994). "The sequence of a 32,420 bp segment located on the right arm of chromosome II from Saccharomyces cerevisiae." Yeast 10 Suppl A:S47-S62.8091861
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418