You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycyl-tRNA synthetase 1
Synonyms
  • Diadenosine tetraphosphate synthetase
  • AP-4-A synthetase
  • Glycine--tRNA ligase 1
  • GlyRS 1
  • GlyRS1
Gene NameGRS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs
Cellular LocationCytoplasm. Mitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Glycine + tRNA(Gly) → Adenosine monophosphate + Pyrophosphate + Gly-tRNA(Gly)
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
glycine-tRNA ligase activity
binding
nucleotide binding
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
Process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
glycyl-tRNA aminoacylation
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR121C
Gene Sequence>2004 bp ATGAGTGTAGAAGATATCAAGAAGGCTAGAGCCGCTGTTCCATTTAACAGAGAACAGCTA GAAAGTGTTTTGAGAGGAAGATTTTTTTATGCCCCAGCTTTTGACTTGTACGGTGGGGTT TCTGGTTTATATGACTATGGTCCACCAGGTTGTGCATTCCAAAACAACATCATTGACGCC TGGAGAAAGCATTTTATTTTGGAAGAAGATATGTTGGAAGTTGATTGTACTATGTTAACT CCATATGAGGTTTTGAAGACCTCAGGTCATGTTGACAAATTTTCTGATTGGATGTGTAGA GATTTGAAGACTGGTGAGATTTTCAGAGCTGACCATTTAGTCGAAGAAGTTTTGGAAGCT CGCTTAAAGGGTGACCAAGAAGCCAGAGGTTTAGTCGAGGATGCTAATGCCGCTGCTAAG GACGATGCCGAAAAGAAGAAGAGAAAGAAAAAAGTTAAACAAATTAAAGCAGTCAAATTG GATGACGACGTTGTCAAAGAATATGAAGAAATTTTGGCTAAAATAGATGGTTATTCCGGC CCAGAATTAGGTGAATTGATGGAAAAATACGATATCGGTAACCCAGTCACCGGAGAAACT TTAGAATCTCCAAGGGCTTTTAACCTGATGTTTGAAACGGCTATTGGCCCATCTGGTCAA TTAAAGGGTTACTTGAGGCCAGAAACTGCCCAAGGTCAATTCTTGAATTTTAACAAGTTG TTAGAATTTAACAACAGTAAGACCCCTTTTGCCTCAGCCTCTATCGGTAAATCATTTAGA AATGAGATTTCCCCAAGGGCCGGTTTATTAAGAGTCCGTGAATTTTTGATGGCAGAGATT GAACATTTCGTTGACCCATTGGACAAATCTCATCCAAAATTTAATGAAATCAAAGACATC AAGCTTTCCTTTTTGCCTCGTGATGTTCAAGAAGCTGGTTCTACTGAACCAATTGTCAAG ACAGTTGGTGAAGCAGTTGCTTCAAGAATGGTCGATAATGAAACTTTGGGTTACTTTATT GCCAGAATTTACCAATTTTTGATGAAAATTGGTGTTGATGAGTCCAAATTGAGATTCCGT CAACATATGGCTAATGAAATGGCACATTATGCTGCTGACTGTTGGGATGGTGAATTGAAG ACATCTTACGGGTGGATTGAATGTGTCGGATGTGCTGATAGATCTGCCTATGATTTGACC GTTCATTCCAAAAAGACCAAAGAAAAATTGGTTGTTAGACAAAAATTAGATAATCCAATT GAAGTCACCAAGTGGGAAATTGATTTGACGAAAAAATTGTTCGGTCCAAAATTCAGAAAA GATGCACCAAAAGTTGAATCTCATCTATTGAATATGTCTCAAGATGACTTGGCTTCCAAG GCTGAGTTATTGAAGGCAAATGGCAAGTTTACTATAAAGGTTGATGGTGTTGATGGCGAA GTCGAGTTGGACGATAAATTGGTTAAAATCGAACAAAGAACAAAGGTTGAACACGTTAGA GAATATGTTCCTAGTGTCATTGAACCATCTTTCGGTATTGGCCGTATCATCTACTCCGTT TTTGAGCACTCTTTCTGGAACAGACCAGAAGACAATGCCAGAAGTGTTCTTTCCTTCCCA CCTTTGGTTGCTCCAACAAAGGTTCTTTTAGTTCCTTTATCTAACCACAAAGATTTAGTT CCTGTTCATCATGAAGTCGCCAAAATCTTAAGAAAGTCTCAAATCCCATTTAAGATTGAT GATTCTGGAGTTTCCATTGGTAAAAGATATGCCCGTAATGACGAATTAGGTACTCCATTC GGTGTCACCATTGACTTTGAATCTGCCAAAGACCATTCTGTCACTTTGAGAGAAAGAGAT TCCACCAAGCAAGTTAGAGGTTCCGTCGAAAATGTCATCAAGGCTATCCGCGATATCACT TACAATGGTGCTTCTTGGGAAGAAGGTACCAAGGATTTGACTCCTTTTATTGCCCAAGCT GAAGCTGAAGCTGAAACTGACTAA
Protein Properties
Pfam Domain Function
Protein Residues667
Protein Molecular Weight75410.20313
Protein Theoretical pI5.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycyl-tRNA synthetase 1 MSVEDIKKARAAVPFNREQLESVLRGRFFYAPAFDLYGGVSGLYDYGPPGCAFQNNIIDA WRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRADHLVEEVLEA RLKGDQEARGLVEDANAAAKDDAEKKKRKKKVKQIKAVKLDDDVVKEYEEILAKIDGYSG PELGELMEKYDIGNPVTGETLESPRAFNLMFETAIGPSGQLKGYLRPETAQGQFLNFNKL LEFNNSKTPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFVDPLDKSHPKFNEIKDI KLSFLPRDVQEAGSTEPIVKTVGEAVASRMVDNETLGYFIARIYQFLMKIGVDESKLRFR QHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTVHSKKTKEKLVVRQKLDNPI EVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKAELLKANGKFTIKVDGVDGE VELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSVFEHSFWNRPEDNARSVLSFP PLVAPTKVLLVPLSNHKDLVPVHHEVAKILRKSQIPFKIDDSGVSIGKRYARNDELGTPF GVTIDFESAKDHSVTLRERDSTKQVRGSVENVIKAIRDITYNGASWEEGTKDLTPFIAQA EAEAETD
References
External Links
ResourceLink
Saccharomyces Genome Database GRS1
Uniprot IDP38088
Uniprot NameSYG_YEAST
GenBank Gene IDX78993
Genebank Protein ID565058
General Reference
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Turner, R. J., Lovato, M., Schimmel, P. (2000). "One of two genes encoding glycyl-tRNA synthetase in Saccharomyces cerevisiae provides mitochondrial and cytoplasmic functions." J Biol Chem 275:27681-27688.10874035
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956