You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSuccinate-semialdehyde dehydrogenase [NADP+]
Synonyms
  • SSDH
Gene NameUGA2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionSuccinate semialdehyde + NAD(P)(+) + H(2)O = succinate + NAD(P)H
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Butanoate metabolismec00650 Map00650
Tyrosine metabolismec00350 Map00350
SMPDB Reactions
Succinic acid semialdehyde + water + NADPNADPH + Succinic acid + hydron
KEGG Reactions
NADP + water + Succinic acid semialdehydeNADPH + hydron + Succinic acid
Metabolites
YMDB IDNameView
YMDB00236Succinic acid semialdehydeShow
YMDB00338Succinic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00992succinate semialdehydeShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
catalytic activity
oxidoreductase activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR006W
Gene Sequence>1494 bp ATGACTTTGAGTAAGTATTCTAAACCAACTCTAAACGACCCTAATTTATTCAGAGAATCT GGTTATATTGACGGAAAATGGGTTAAGGGCACTGACGAAGTTTTTGAGGTGGTAGACCCT GCTTCCGGCGAAATCATAGCAAGAGTTCCCGAACAACCAGTCTCCGTGGTTGAGGAAGCG ATTGATGTTGCCTATGAAACTTTCAAGACGTACAAGAATACAACACCAAGAGAGAGGGCA AAGTGGCTCAGAAACATGTATAACTTAATGCTTGAAAATTTGGATGATCTGGCAACCATC ATTACTTTAGAAAATGGTAAAGCTCTAGGGGAAGCTAAAGGAGAAATCAAATACGCGGCT TCGTATTTTGAGTGGTACGCCGAGGAAGCACCCCGTTTATATGGTGCTACTATTCAACCC TTGAACCCTCACAACAGAGTATTCACAATTAGGCAACCTGTTGGTGTATGCGGTATAATT TGTCCATGGAATTTTCCGAGCGCCATGATCACGAGAAAGGCCGCCGCTGCTTTAGCTGTG GGCTGCACAGTAGTCATCAAGCCAGACTCTCAAACGCCGCTATCTGCTTTAGCAATGGCA TATTTGGCTGAAAAGGCAGGCTTTCCCAAGGGTTCGTTTAATGTTATTCTTTCACATGCC AACACACCAAAGCTTGGTAAAACATTATGTGAATCACCAAAAGTCAAGAAAGTTACTTTT ACTGGTTCTACAAACGTCGGTAAAATCTTGATGAAACAATCTTCTTCTACTTTGAAGAAA CTGTCTTTTGAGCTGGGTGGTAACGCCCCTTTCATAGTCTTTGAGGATGCCGATTTGGAT CAAGCCTTGGAACAAGCCATGGCTTGTAAATTTAGGGGTTTGGGTCAAACATGTGTGTGC GCAAATAGACTTTACGTTCACTCATCCATAATTGATAAATTTGCGAAATTACTCGCGGAG AGGGTCAAAAAATTCGTAATTGGCCATGGTTTGGACCCAAAAACTACACATGGTTGTGTC ATTAACTCCAGCGCTATTGAAAAAGTTGAAAGACATAAACAGGATGCCATTGATAAGGGA GCAAAAGTTGTGCTTGAAGGTGGACGTTTAACTGAGTTAGGTCCTAACTTTTATGCTCCA GTAATTTTGTCACACGTTCCCTCAACAGCTATTGTTTCCAAGGAGGAGACTTTTGGTCCA TTATGTCCAATCTTTTCTTTTGATACTATGGAAGAAGTTGTCGGATATGCTAATGATACT GAGTTTGGTTTAGCAGCATATGTCTTTTCTAAAAATGTCAACACTTTATACACTGTGTCT GAAGCTTTGGAAACTGGTATGGTTTCATGTAATACAGGTGTTTTTTCGGATTGTTCTATA CCATTTGGTGGTGTTAAAGAGTCAGGATTTGGAAGAGAAGGTTCGCTATATGGTATTGAA GATTACACTGTTTTGAAGACCATCACAATTGGGAATTTGCCAAACAGCATTTAA
Protein Properties
Pfam Domain Function
Protein Residues497
Protein Molecular Weight54188.80078
Protein Theoretical pI6.62
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Succinate-semialdehyde dehydrogenase [NADP+] MTLSKYSKPTLNDPNLFRESGYIDGKWVKGTDEVFEVVDPASGEIIARVPEQPVSVVEEA IDVAYETFKTYKNTTPRERAKWLRNMYNLMLENLDDLATIITLENGKALGEAKGEIKYAA SYFEWYAEEAPRLYGATIQPLNPHNRVFTIRQPVGVCGIICPWNFPSAMITRKAAAALAV GCTVVIKPDSQTPLSALAMAYLAEKAGFPKGSFNVILSHANTPKLGKTLCESPKVKKVTF TGSTNVGKILMKQSSSTLKKLSFELGGNAPFIVFEDADLDQALEQAMACKFRGLGQTCVC ANRLYVHSSIIDKFAKLLAERVKKFVIGHGLDPKTTHGCVINSSAIEKVERHKQDAIDKG AKVVLEGGRLTELGPNFYAPVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYANDT EFGLAAYVFSKNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGVKESGFGREGSLYGIE DYTVLKTITIGNLPNSI
References
External Links
ResourceLink
Saccharomyces Genome Database UGA2
Uniprot IDP38067
Uniprot NameUGA2_YEAST
GenBank Gene IDZ35875
Genebank Protein ID4388565
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418