You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenine phosphoribosyltransferase 2
Synonyms
  • APRT 2
Gene NameAPT2
Enzyme Class
Biological Properties
General FunctionInvolved in adenine phosphoribosyltransferase activity
Specific FunctionCatalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. May lack catalytic activity
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00219PyrophosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00887AdenineShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
transferase activity, transferring pentosyl groups
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
adenine phosphoribosyltransferase activity
Process
cellular aromatic compound metabolic process
nucleobase metabolic process
nucleoside metabolic process
purine base metabolic process
purine base biosynthetic process
metabolic process
purine base salvage
adenine salvage
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR441C
Gene Sequence>546 bp ATGTCTATTTCTGAATCTTACGCAAAGGAAATAAAAACTGCATTTAGGCAGTTCACTGAC TTTCCCATAGAGGGTGAGCAATTTGAGGATTTTTTACCTATTATTGGCAACCCCACGCTA TTCCAAAAGTTGGTACACACGTTCAAGACGCATTTAGAAGAAAAGTTCGCCAAAGAAAAG ATCGACTTTATTGCAGGTATAGAAGCTAGAGGCCTTCTATTTGGGCCATCCCTAGCACTG GCATTGGGAGTTGGATTTGTTCCAATAAGGAGAGTTGGAAAATTGCCGGGTGAGTGTGCT TCTATAACATTCACAAAATTAGACCATGAAGAAATTTTTGAAATGCAGGTTGAAGCCATT CCCTTTGATTCCAACGTGGTTGTCGTGGATGATGTTCTCGCCACCGGTGGAACGGCATAT GCTGCGGGCGACCTTATCAGACAAGTGGGTGCTCATATTCTGGAATATGACTTTGTGCTA GTGTTAGATAGTCTACATGGTGAGGAGAAATTATCTGCTCCTATTTTTTCCATATTGCAC TCCTGA
Protein Properties
Pfam Domain Function
Protein Residues181
Protein Molecular Weight19999.80078
Protein Theoretical pI4.58
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenine phosphoribosyltransferase 2 MSISESYAKEIKTAFRQFTDFPIEGEQFEDFLPIIGNPTLFQKLVHTFKTHLEEKFAKEK IDFIAGIEARGLLFGPSLALALGVGFVPIRRVGKLPGECASITFTKLDHEEIFEMQVEAI PFDSNVVVVDDVLATGGTAYAAGDLIRQVGAHILEYDFVLVLDSLHGEEKLSAPIFSILH S
References
External Links
ResourceLink
Saccharomyces Genome Database APT2
Uniprot IDP36973
Uniprot NameAPT2_YEAST
GenBank Gene IDL14434
Genebank Protein ID295575
General Reference
  • Yuryev, A., Corden, J. L. (1994). "A Saccharomyces cerevisiae gene encoding a potential adenine phosphoribosyltransferase." Yeast 10:659-662.7941749
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Alfonzo, J. D., Crother, T. R., Guetsova, M. L., Daignan-Fornier, B., Taylor, M. W. (1999). "APT1, but not APT2, codes for a functional adenine phosphoribosyltransferase in Saccharomyces cerevisiae." J Bacteriol 181:347-352.9864350
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106