You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNAD-dependent malic enzyme, mitochondrial
Synonyms
  • NAD-ME
Gene NameMAE1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific Function(S)-malate + NAD(+) = pyruvate + CO(2) + NADH
Cellular LocationMitochondrion matrix
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Pyruvic acid + Carbon dioxide + NADH + hydron(S)-Malic acid + NAD
NADH + hydron + Oxalacetic acid(S)-Malic acid + NAD
KEGG Reactions
NAD + (S)-malate(2-)NADH + Pyruvic acid + Carbon dioxide
NADP + (S)-malate(2-)Pyruvic acid + Carbon dioxide + NADPH
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00175Pyruvic acidShow
YMDB00235Oxalacetic acidShow
YMDB00280(S)-Malic acidShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
cation binding
metal ion binding
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
catalytic activity
NAD or NADH binding
malate dehydrogenase activity
binding
malic enzyme activity
nucleotide binding
ion binding
Process
oxidation reduction
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
metabolic process
dicarboxylic acid metabolic process
cellular metabolic process
malate metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL029C
Gene Sequence>2010 bp ATGCTTAGAACCAGACTATCCGTTTCCGTTGCTGCTAGATCGCAACTAACCAGATCCTTG ACAGCATCAAGGACAGCACCATTAAGAAGATGGCCTATTCAGCAATCGCGTTTATATTCT TCTAACACTAGATCGCATAAAGCTACCACAACAAGAGAAAATACTTTCCAAAAGCCATAC AGCGACGAGGAGGTCACTAAAACACCCGTCGGTTCTCGCGCCAGAAAGATCTTCGAAGCT CCTCACCCACATGCCACTCGTTTGACTGTAGAAGGTGCCATAGAATGTCCCTTGGAGAGC TTTCAACTTTTAAACTCTCCTTTATTTAACAAGGGTTCTGCATTTACACAAGAAGAAAGG GAAGCGTTTAATTTAGAAGCATTGCTACCACCACAAGTGAACACTTTGGACGAACAACTG GAAAGAAGCTACAAGCAGTTATGCTATTTGAAGACGCCCTTGGCCAAAAACGACTTCATG ACGTCTTTGAGAGTACAGAACAAAGTCCTATATTTTGCATTAATAAGGAGACATATCAAG GAATTAGTTCCTATCATTTACACCCCAACCGAAGGTGATGCTATTGCTGCCTATTCCCAC AGGTTCAGAAAGCCAGAAGGTGTGTTTTTAGACATTACCGAACCTGATTCCATCGAATGT AGATTGGCTACATACGGTGGAGACAAAGATGTAGACTACATCGTTGTGTCGGATTCGGAA GGTATTCTGGGAATTGGTGACCAAGGTATCGGTGGTGTACGTATTGCTATCTCCAAATTG GCATTGATGACGCTGTGCGGTGGTATTCATCCCGGCCGTGTGCTACCTGTGTGTTTGGAC GTCGGTACTAACAACAAGAAACTAGCCCGTGACGAATTGTACATGGGTAACAAGTTCTCC AGAATCAGGGGTAAGCAATATGACGACTTCTTGGAAAAATTCATCAAGGCCGTTAAGAAA GTGTATCCAAGCGCCGTTCTGCATTTCGAAGATTTCGGTGTTAAGAACGCTAGAAGATTA CTAGAAAAGTACAGGTACGAATTGCCATCATTCAACGATGACATTCAGGGCACCGGTGCC GTCGTGATGGCCTCGTTGATTGCTGCTTTGAAACATACCAACAGAGACTTGAAAGACACC AGAGTGCTTATTTACGGTGCCGGGTCTGCGGGCCTCGGTATCGCAGATCAAATTGTGAAT CATATGGTCACGCACGGCGTTGACAAGGAAGAAGCGCGCAAGAAAATCTTCTTGATGGAC AGACGTGGGTTAATTCTACAATCTTACGAGGCTAACTCCACTCCCGCCCAACACGTATAC GCTAAGAGTGATGCGGAATGGGCTGGTATCAACACCCGCTCTTTACATGATGTGGTGGAG AACGTCAAACCAACGTGTTTGGTTGGCTGCTCCACACAAGCAGGCGCATTCACTCAAGAT GTCGTAGAAGAAATGCACAAGCACAATCCTAGACCGATCATTTTCCCATTATCCAACCCT ACTAGACTACACGAAGCCGTTCCTGCCGATTTAATGAAGTGGACCAACAACAACGCTCTT GTAGCTACCGGATCTCCTTTCCCACCTGTTGATGGTTACCGTATCTCGGAGAACAACAAT TGTTACTCTTTCCCAGGTATCGGTTTAGGTGCCGTACTATCGCGTGCCACCACCATCACA GACAAGATGATCTCCGCTGCAGTGGACCAACTAGCCGAATTGTCGCCACTAAGAGAGGGC GACTCGAGACCTGGGTTGCTACCCGGCCTGGACACCATCACCAACACTTCTGCGCGTCTA GCTACCGCTGTGATCTTGCAAGCACTCGAGGAGGGAACCGCCCGTATCGAGCAAGAACAA GTACCGGGAGGAGCTCCCGGCGAAACTGTCAAGGTTCCTCGTGACTTTGACGAATGTTTA CAGTGGGTCAAAGCCCAAATGTGGGAGCCTGTGTACAGACCTATGATCAAGGTCCAACAT GACCCATCGGTGCACACCAACCAATTGTAG
Protein Properties
Pfam Domain Function
Protein Residues669
Protein Molecular Weight74375.29688
Protein Theoretical pI8.3
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NAD-dependent malic enzyme, mitochondrial MLRTRLSVSVAARSQLTRSLTASRTAPLRRWPIQQSRLYSSNTRSHKATTTRENTFQKPY SDEEVTKTPVGSRARKIFEAPHPHATRLTVEGAIECPLESFQLLNSPLFNKGSAFTQEER EAFNLEALLPPQVNTLDEQLERSYKQLCYLKTPLAKNDFMTSLRVQNKVLYFALIRRHIK ELVPIIYTPTEGDAIAAYSHRFRKPEGVFLDITEPDSIECRLATYGGDKDVDYIVVSDSE GILGIGDQGIGGVRIAISKLALMTLCGGIHPGRVLPVCLDVGTNNKKLARDELYMGNKFS RIRGKQYDDFLEKFIKAVKKVYPSAVLHFEDFGVKNARRLLEKYRYELPSFNDDIQGTGA VVMASLIAALKHTNRDLKDTRVLIYGAGSAGLGIADQIVNHMVTHGVDKEEARKKIFLMD RRGLILQSYEANSTPAQHVYAKSDAEWAGINTRSLHDVVENVKPTCLVGCSTQAGAFTQD VVEEMHKHNPRPIIFPLSNPTRLHEAVPADLMKWTNNNALVATGSPFPPVDGYRISENNN CYSFPGIGLGAVLSRATTITDKMISAAVDQLAELSPLREGDSRPGLLPGLDTITNTSARL ATAVILQALEEGTARIEQEQVPGGAPGETVKVPRDFDECLQWVKAQMWEPVYRPMIKVQH DPSVHTNQL
References
External Links
ResourceLink
Saccharomyces Genome Database MAE1
Uniprot IDP36013
Uniprot NameMAOM_YEAST
GenBank Gene IDZ28029
Genebank Protein ID486030
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Boles, E., de Jong-Gubbels, P., Pronk, J. T. (1998). "Identification and characterization of MAE1, the Saccharomyces cerevisiae structural gene encoding mitochondrial malic enzyme." J Bacteriol 180:2875-2882.9603875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278