You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcid phosphatase PHO11
Synonyms
  • P56
Gene NamePHO11
Enzyme Class
Biological Properties
General FunctionInvolved in acid phosphatase activity
Specific FunctionA phosphate monoester + H(2)O = an alcohol + phosphate
Cellular LocationCytoplasmic
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
Thiamine monophosphate + waterThiamine + phosphate
KEGG Reactions
Flavin Mononucleotide + water Riboflavin + phosphate
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00164Thiamine monophosphateShow
YMDB00220ThiamineShow
YMDB00534RiboflavinShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
acid phosphatase activity
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 1
LocusYAR071W
Gene Sequence>1404 bp ATGTTGAAGTCAGCCGTTTATTCAATTTTAGCCGCTTCTTTGGTTAATGCAGGTACCATA CCCCTCGGAAAGTTATCTGACATTGACAAAATCGGAACTCAAACGGAAATTTTCCCATTT TTGGGTGGTTCTGGGCCATACTACTCTTTCCCTGGTGATTATGGTATTTCTCGTGATTTG CCGGAAAGTTGTGAAATGAAGCAAGTGCAAATGGTTGGTAGACACGGTGAAAGATACCCC ACTGTCAGCAAAGCCAAAAGTATCATGACAACATGGTACAAATTGAGTAACTATACCGGT CAATTCAGCGGAGCATTGTCTTTCTTGAACGATGACTACGAATTTTTCATTCGTGACACC AAAAACCTAGAAATGGAAACCACACTTGCCAATTCGGTCAATGTTTTGAACCCATATACC GGTGAGATGAATGCTAAGAGACACGCTCGTGATTTCTTGGCGCAATATGGCTACATGGTC GAAAACCAAACCAGTTTTGCCGTTTTTACGTCTAACTCGAACAGATGTCATGATACTGCC CAGTATTTCATTGACGGTTTGGGTGATAAATTCAACATATCCTTGCAAACCATCAGTGAA GCCGAGTCTGCTGGTGCCAATACTCTGAGTGCCCACCATTCGTGTCCTGCTTGGGACGAT GATGTCAACGATGACATTTTGAAAAAATATGATACCAAATATTTGAGTGGTATTGCCAAG AGATTAAACAAGGAAAACAAGGGTTTGAATCTGACTTCAAGTGATGCAAACACTTTTTTT GCATGGTGTGCATATGAAATAAACGCTAGAGGTTACAGTGACATCTGTAACATCTTCACC AAAGATGAATTGGTCCGTTTCTCCTACGGCCAAGACTTGGAAACTTATTATCAAACGGGA CCAGGCTATGACGTCGTCAGATCCGTCGGTGCCAACTTGTTCAACGCTTCAGTGAAACTA CTAAAGGAAAGTGAGGTCCAGGACCAAAAGGTTTGGTTGAGTTTCACCCACGATACCGAT ATTCTGAACTATTTGACCACTATCGGCATAATCGATGACAAAAATAACTTGACCGCCGAA CATGTTCCATTCATGGAAAACACTTTCCACAGATCCTGGTACGTTCCACAAGGTGCTCGT GTTTACACTGAAAAGTTCCAGTGTTCCAATGACACCTATGTTAGATACGTCATCAACGAT GCTGTCGTTCCAATTGAAACCTGTTCTACTGGTCCAGGGTTCTCCTGTGAAATAAATGAC TTCTACGACTATGCTGAAAAGAGAGTAGCCGGTACTGACTTCCTAAAGGTCTGTAACGTC AGCAGCGTCAGTAACTCTACTGAATTGACCTTTTTCTGGGACTGGAATACCAAGCACTAC AACGACACTTTATTAAAACAGTAA
Protein Properties
Pfam Domain Function
Protein Residues467
Protein Molecular Weight52757.39844
Protein Theoretical pI4.78
Signalling Regions
  • 1-17
Transmembrane Regions
  • None
Protein Sequence>Acid phosphatase PHO11 MLKSAVYSILAASLVNAGTIPLGKLSDIDKIGTQTEIFPFLGGSGPYYSFPGDYGISRDL PESCEMKQVQMVGRHGERYPTVSKAKSIMTTWYKLSNYTGQFSGALSFLNDDYEFFIRDT KNLEMETTLANSVNVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSNRCHDTA QYFIDGLGDKFNISLQTISEAESAGANTLSAHHSCPAWDDDVNDDILKKYDTKYLSGIAK RLNKENKGLNLTSSDANTFFAWCAYEINARGYSDICNIFTKDELVRFSYGQDLETYYQTG PGYDVVRSVGANLFNASVKLLKESEVQDQKVWLSFTHDTDILNYLTTIGIIDDKNNLTAE HVPFMENTFHRSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND FYDYAEKRVAGTDFLKVCNVSSVSNSTELTFFWDWNTKHYNDTLLKQ
References
External Links
ResourceLink
Saccharomyces Genome Database PHO11
Uniprot IDP35842
Uniprot NamePPAB_YEAST
GenBank Gene IDL28920
Genebank Protein ID456155
General Reference
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106