You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3-oxoacyl-[acyl-carrier-protein] reductase
Synonyms
  • 3-ketoacyl-acyl carrier protein reductase
Gene NameOAR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionInvolved in biosynthesis of fatty acids in mitochondria
Cellular LocationMitochondrion
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid biosynthesisPW002458 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Fatty acid biosynthesisec00061 Map00061
SMPDB Reactions
3-oxooctadecanoyl-CoA + hydron + NADPHNADP + (3R)-3-hydroxy-stearoyl-CoA
3-oxodocosanoyl-CoA + hydron + NADPHNADP + (3R)-3-hydroxy-docosanoyl-CoA
3-oxoicosanoyl-CoA + NADPH + hydron(3R)-3-hydroxy-arachidoyl-CoA + NADP
3-oxotetracosanoyl-CoA + NADPH + hydron(3R)-hydroxytetracosanoyl-CoA + NADP
3-oxohexacosanoyl-CoA + hydron + NADPHNADP + (3R)-hydroxyhexacosanoyl-CoA
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004773-oxooctadecanoyl-CoAShow
YMDB007323-oxoicosanoyl-CoAShow
YMDB007333-oxodocosanoyl-CoAShow
YMDB007353-oxotetracosanoyl-CoAShow
YMDB00862hydronShow
YMDB009603-oxohexacosanoyl-CoAShow
YMDB16292(3R)-3-hydroxy-stearoyl-CoAShow
YMDB16293(3R)-3-hydroxy-arachidoyl-CoAShow
YMDB16295(3R)-3-hydroxy-docosanoyl-CoA Show
YMDB16297(3R)-hydroxytetracosanoyl-CoAShow
YMDB16299(3R)-hydroxyhexacosanoyl-CoAShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL055C
Gene Sequence>837 bp ATGCATTATTTGCCTGTTGCGATAGTAACAGGTGCCACTAGGGGTATAGGCAAGGCAATA TGTCAAAAGTTATTTCAAAAGGGTTTAAGTTGCATTATACTTGGGTCTACTAAAGAAAGT ATAGAGCGCACCGCGATAGATAGAGGCCAATTACAATCGGGATTATCATATCAGCGGCAA TGTGCTATAGCAATTGATTTTAAGAAATGGCCTCACTGGCTTGACTATGAGTCATATGAC GGTATCGAATATTTCAAAGATAGACCGCCCTTGAAACAGAAATATTCCACATTGTTCGAC CCATGTAACAAATGGTCAAATAATGAACGCCGCTACTACGTAAACTTATTGATTAACTGC GCAGGCTTGACTCAAGAATCATTAAGTGTAAGAACCACTGCATCTCAAATTCAGGACATA ATGAATGTTAACTTTATGAGCCCTGTGACGATGACAAACATCTGTATTAAGTATATGATG AAGTCGCAAAGGAGATGGCCGGAACTCAGTGGTCAATCTGCTCGACCCACCATCGTAAAT ATTTCCTCCATTCTACACTCCGGAAAAATGAAGGTTCCAGGTACATCTGTTTACTCCGCC TCTAAAGCCGCGCTGTCCAGATTTACAGAAGTTTTAGCTGCAGAAATGGAACCAAGAAAC ATTAGGTGTTTTACGATATCTCCAGGTTTAGTCAAAGGGACCGATATGATCCAAAATTTG CCAGTGGAGGCTAAAGAAATGCTGGAGAGAACCATTGGGGCAAGCGGTACAAGCGCACCC GCTGAAATAGCGGAAGAAGTCTGGTCTCTATACAGTAGAACTGCTTTGGAGACGTAA
Protein Properties
Pfam Domain Function
Protein Residues278
Protein Molecular Weight31183.69922
Protein Theoretical pI9.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3-oxoacyl-[acyl-carrier-protein] reductase MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQ CAIAIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINC AGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVN ISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNL PVEAKEMLERTIGASGTSAPAEIAEEVWSLYSRTALET
References
External Links
ResourceLink
Saccharomyces Genome Database OAR1
Uniprot IDP35731
Uniprot NameFABG_YEAST
GenBank Gene IDX75781
Genebank Protein ID433642
General Reference
  • Rasmussen, S. W. (1994). "Sequence of a 28.6 kb region of yeast chromosome XI includes the FBA1 and TOA2 genes, an open reading frame (ORF) similar to a translationally controlled tumour protein, one ORF containing motifs also found in plant storage proteins and 13 ORFs with weak or no homology to known proteins." Yeast 10 Suppl A:S63-S68.8091862
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Schneider, R., Brors, B., Burger, F., Camrath, S., Weiss, H. (1997). "Two genes of the putative mitochondrial fatty acid synthase in the genome of Saccharomyces cerevisiae." Curr Genet 32:384-388.9388293
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106