You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSorbitol dehydrogenase 1
Synonyms
  • L-iditol 2-dehydrogenase 1
Gene NameSOR1
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionL-iditol + NAD(+) = L-sorbose + NADH
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
D-glucitol + NADNADH + hydron + keto-D-fructose
KEGG Reactions
NAD + D-glucitolNADH + D-Fructose + hydron
NAD + L-glucitolNADH + hydron + L-Sorbose
Metabolites
YMDB IDNameView
YMDB00087L-IditolShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00204L-SorboseShow
YMDB00412NAD(+)Show
YMDB00656D-glucitolShow
YMDB00657D-FructoseShow
YMDB00724L-glucitolShow
YMDB00862hydronShow
YMDB16291keto-D-fructoseShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
zinc ion binding
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR159W
Gene Sequence>1074 bp ATGTCTCAAAATAGTAACCCTGCAGTAGTTCTAGAGAAAGTCGGCGATATTGCCATCGAG CAAAGACCAATCCCTACCATTAAGGACCCCCATTATGTCAAGTTAGCTATTAAAGCCACT GGTATCTGCGGCTCTGATATTCATTATTATAGAAGCGGTGGTATTGGTAAGTACATATTG AAGGCGCCAATGGTTTTAGGTCATGAATCAAGCGGACAGGTTGTGGAAGTTGGTGATGCC GTCACAAGGGTCAAAGTTGGTGACCGTGTTGCTATTGAACCTGGTGTTCCTAGCCGTTAC TCTGATGAGACCAAAGAAGGGAGGTATAACCTTTGCCCACATATGGCATTTGCTGCAACT CCTCCAATTGATGGTACTCTTGTGAAGTACTATTTATCTCCAGAAGATTTCCTTGTGAAA TTGCCAGAAGGCGTCAGTTATGAAGAGGGCGCTTGTGTCGAACCCTTATCAGTCGGTGTA CACTCTAATAAATTGGCTGGGGTCCGCTTTGGTACCAAAGTTGTTGTATTTGGTGCAGGT CCTGTGGGGCTTTTAACTGGCGCAGTCGCCCGCGCTTTTGGTGCCACCGACGTCATTTTC GTCGATGTATTCGACAACAAGCTACAGAGAGCAAAAGATTTCGGAGCCACAAACACTTTC AATTCTTCCCAGTTTTCCACCGATAAAGCCCAAGACTTGGCCGATGGGGTCCAAAAGCTT TTGGGCGGAAATCACGCAGATGTGGTGTTTGAGTGTTCAGGTGCTGATGTTTGCATTGAT GCCGCTGTCAAAACAACTAAGGTTGGAGGTACCATGGTGCAAGTCGGTATGGGTAAAAAC TACACTAATTTTCCAATTGCTGAAGTTAGTGGAAAGGAAATGAAATTGATTGGATGTTTC CGTTATTCATTCGGTGATTATCGTGACGCTGTGAACTTGGTTGCCACAGGAAAAGTCAAT GTCAAGCCATTGATAACCCACAAATTTAAATTTGAAGATGCAGCCAAGGCTTACGACTAC AACATTGCCCATGGTGGAGAGGTAGTCAAGACTATTATCTTTGGTCCTGAATGA
Protein Properties
Pfam Domain Function
Protein Residues357
Protein Molecular Weight38165.39844
Protein Theoretical pI6.94
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sorbitol dehydrogenase 1 MSQNSNPAVVLEKVGDIAIEQRPIPTIKDPHYVKLAIKATGICGSDIHYYRSGGIGKYIL KAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAAT PPIDGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAG PVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKL LGGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKEMKLIGCF RYSFGDYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTIIFGPE
References
External Links
ResourceLink
Saccharomyces Genome Database SOR1
Uniprot IDP35497
Uniprot NameDHSO1_YEAST
GenBank Gene IDAY693012
Genebank Protein ID51013475
General Reference
  • Sarthy, A. V., Schopp, C., Idler, K. B. (1994). "Cloning and sequence determination of the gene encoding sorbitol dehydrogenase from Saccharomyces cerevisiae." Gene 140:121-126.8125328
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287