Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMannosyl phosphorylinositol ceramide synthase regulatory protein CSG2
SynonymsNot Available
Gene NameCSG2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in enzyme regulator activity
Specific FunctionRequired for calcium regulation. May regulate calcium accumulation by a non-vacuole organelle. Also regulates the activity of CSH1 and SUR1 during mannosyl phosphorylinositol ceramide synthesis
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
2-Methylbutanal + NADPH + hydronNADP + 2-methylbutan-1-ol
Phenylacetaldehyde + NADPH + hydronNADP + 2-phenylethanol
3-methylbutanal + NADPH + hydronNADP + isoamylol
isobutyraldehyde + NADPH + hydronNADP + isobutanol
Metabolites
YMDB IDNameView
YMDB00116PhenylacetaldehydeShow
YMDB00202Guanosine diphosphate mannoseShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00482isobutyraldehydeShow
YMDB004852-MethylbutanalShow
YMDB004993-methylbutanalShow
YMDB005672-methylbutan-1-olShow
YMDB00570isoamylolShow
YMDB00573isobutanolShow
YMDB00712inositol-P-ceramide C (C26)Show
YMDB00862hydronShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR036C
Gene Sequence>1233 bp ATGTCTACCACACTACTTTGGTTTTCAAGTGTAATAGGCTACGTGATTCAAACAAAATGT TTGTCTAACATACAATCTAAAAAGGAAATCTCCGTGGGGCCCAATGGTACAATTGCAACG CCTGAAACTAACGGCGACAACGGAAACTCAAGTTCATTAACCTTCTATCTGACCTTTATG TATTTTGCTTCGTGGCTGCTCTTGGTGCCTGCATCTCGACTTTGGGAGAAGATGAGACCG ATGTTTGTCTCTGACTCAGACTCGAACAGGAATTCTCAGTTTGACAACAACAACAGCGGG TCTGTGACAAACGAAGATGTCGATACGTTCTCGCACGTGTTGGATGATCCTCAACCACGG ATTCCAGCCCAACAGCAGAAGCAAAAAATCATATCCGTGGCTACCTTCAAATATGTGGCT AAGCTAACAGTGCTGGCTCTCATAATGATTGTCGCTGATTTGACTTATAACATGGCTTTG TCATTGTCACCGGCATTTGATGTTGCTTTGATGCAAAATACTGCCATTTTCGAAATTGTC ACTTTACTATATGGTGTTTGTGGAATCTCCAGGAAGAACTACGTTTTCCGTAATTTCCTC ATCATGATGAACGCGGTCATTGGAATTTTGATCATCTCATACACGAAGGCTACCTGTGAC ATGCTTGCCGGAAAGCTGTCCGTCAACCCTAACACGGGTGAACTTTCTGACCCATTCTTG TTTGATAGGTTGAAAGGTGCTCTGATTTGCGGCCTTGGTGCTTTGATTATGGGTCCTTTT GCCGTGTTATGGAACCGTTGGTTTTGCAGTAACATTTCCAAGAACGAAAATTCTGCTGTA GTCTTGGTTAAGCAGAGCACCCACATGGCCCTAATCGGTATTATTGGCATGGTAATACTT TTGCCATTTATTCCTAAATTTCCCTCCCGTGAGTCTGTGGAATCCATTTCGTTGTTCTAT AATGACAAGAGCTTTTGGTTCTCTCTACTAGGCTCGATTATCTTTGGTTCCTTGCCGAGC TTGATTTCGATATTAGAGTTGAATCGCAAGGCCCCTGCTGAGTATTTGACGACGTGCAAC CTGGGAGCTATTATCTTTATGGGGTTAGCTGAGTGGGTTTGCGAACCTACGCAAACCACA ATTGTGAGATGGGAAGTCATAGGATACATAATGCTAACGGTAAGTTTGTTGGTCCTATCA GTAACACTCGGGGAAGGTAAATACCACCATTAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues410
Protein Molecular Weight45441.60156
Protein Theoretical pI7.33
Signalling Regions
  • 1-17
Transmembrane Regions
  • 51-71
  • 142-161
  • 168-187
  • 198-217
  • 246-265
  • 286-305
  • 325-344
  • 356-374
  • 386-404
Protein Sequence>Mannosyl phosphorylinositol ceramide synthase regulatory protein CSG2 MSTTLLWFSSVIGYVIQTKCLSNIQSKKEISVGPNGTIATPETNGDNGNSSSLTFYLTFM YFASWLLLVPASRLWEKMRPMFVSDSDSNRNSQFDNNNSGSVTNEDVDTFSHVLDDPQPR IPAQQQKQKIISVATFKYVAKLTVLALIMIVADLTYNMALSLSPAFDVALMQNTAIFEIV TLLYGVCGISRKNYVFRNFLIMMNAVIGILIISYTKATCDMLAGKLSVNPNTGELSDPFL FDRLKGALICGLGALIMGPFAVLWNRWFCSNISKNENSAVVLVKQSTHMALIGIIGMVIL LPFIPKFPSRESVESISLFYNDKSFWFSLLGSIIFGSLPSLISILELNRKAPAEYLTTCN LGAIIFMGLAEWVCEPTQTTIVRWEVIGYIMLTVSLLVLSVTLGEGKYHH
References
External Links
ResourceLink
Saccharomyces Genome Database CSG2
Uniprot IDP35206
Uniprot NameCSG2_YEAST
GenBank Gene IDD28120
Genebank Protein ID976270
General Reference
  • Beeler, T., Gable, K., Zhao, C., Dunn, T. (1994). "A novel protein, CSG2p, is required for Ca2+ regulation in Saccharomyces cerevisiae." J Biol Chem 269:7279-7284.8125941
  • Takita, Y., Ohya, Y., Anraku, Y. (1995). "The CLS2 gene encodes a protein with multiple membrane-spanning domains that is important Ca2+ tolerance in yeast." Mol Gen Genet 246:269-281.7854312
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Smits, P. H., De Haan, M., Maat, C., Grivell, L. A. (1994). "The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene." Yeast 10 Suppl A:S75-S80.8091864
  • Schulze, M., Rodel, G. (1989). "Accumulation of the cytochrome c oxidase subunits I and II in yeast requires a mitochondrial membrane-associated protein, encoded by the nuclear SCO1 gene." Mol Gen Genet 216:37-43.2543907
  • Uemura, S., Kihara, A., Inokuchi, J., Igarashi, Y. (2003). "Csg1p and newly identified Csh1p function in mannosylinositol phosphorylceramide synthesis by interacting with Csg2p." J Biol Chem 278:45049-45055.12954640
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258