You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoserine aminotransferase
Synonyms
  • PSAT
  • Phosphohydroxythreonine aminotransferase
Gene NameSER1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionCatalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine
Cellular LocationNot Available
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
Vitamin B6 metabolismec00750 Map00750
SMPDB Reactions
Phosphohydroxypyruvic acid + L-Glutamic acidOxoglutaric acid + DL-O-Phosphoserine
KEGG Reactions
L-Glutamic acid + 2-Oxo-3-hydroxy-4-phosphobutanoic acidOxoglutaric acid + O-Phospho-4-hydroxy-L-threonine
Phosphohydroxypyruvic acid + L-Glutamic acidO-Phospho-L-serine + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB00076DL-O-PhosphoserineShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00355O-Phospho-4-hydroxy-L-threonineShow
YMDB003842-Oxo-3-hydroxy-4-phosphobutanoic acidShow
YMDB00393Phosphohydroxypyruvic acidShow
YMDB00761O-Phospho-L-serineShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
cofactor binding
pyridoxal phosphate binding
Process
serine family amino acid metabolic process
L-serine metabolic process
L-serine biosynthetic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR184W
Gene Sequence>1188 bp ATGTCTTTGGAAAGAGAGGAACCACAACATTTCGGAGCAGGGCCAGCTCAAATGCCTACA CCAGTTTTGCAACAAGCTGCTAAAGACTTAATCAATTTCAATGACATAGGTTTGGGTATC GGTGAAATTTCTCACCGTTCGAAGGATGCCACCAAAGTGATTGAAGACTCTAAGAAGCAC TTAATCGAACTGCTAAATATTCCTGACACTCATGAAGTGTTCTACTTGCAAGGTGGTGGC ACTACTGGTTTTTCTTCCGTTGCTACTAATTTGGCAGCTGCATATGTGGGTAAGCATGGG AAGATTGCACCTGCCGGTTATTTAGTCACCGGTAGTTGGTCTCAGAAATCTTTTGAAGAG GCAAAGAGATTGCACGTTCCTGCTGAAGTTATCTTCAACGCTAAAGATTATAACAATGGC AAATTTGGTAAAATTCCGGATGAATCCCTTTGGGAAGATAAAATCAAAGGTAAGGCTTTC TCATACGTGTACCTATGTGAGAATGAAACTGTTCATGGTGTTGAATGGCCAGAATTACCA AAATGTTTAGTAAACGACCCCAACATCGAAATTGTTGCTGACTTATCCAGCGACATTTTG TCTCGTAAGATTGACGTTTCTCAATACGGTGTCATCATGGCAGGCGCCCAAAAAAACATT GGTTTAGCAGGCTTAACCCTATACATTATCAAGAAATCCATCCTTAAGAATATTTCTGGC GCTTCTGATGAAACATTACATGAATTGGGAGTACCAATCACCCCTATTGCATTCGACTAT CCAACGGTGGTGAAGAACAACTCAGCCTATAATACAATTCCAATTTTCACTTTACATGTT ATGGATCTCGTGTTCCAACATATTTTGAAGAAGGGTGGTGTTGAAGCGCAACAGGCTGAA AATGAAGAAAAGGCCAAGATATTATATGAGGCATTGGATGCAAATTCAGATTTTTACAAC GTTCCAGTGGATCCAAAGTGTAGATCAAAAATGAATGTCGTTTTCACCCTTAAAAAGGAC GGCCTTGATGACCAGTTTCTAAAAGAGGCAGCTGCTCGTCATTTAACCGGTTTGAAAGGA CATCGTTCAGTTGGTGGGTTCAGAGCCTCCATCTATAACGCGCTTTCAGTGAAAGCTGTA CAAAACTTGGTAGATTTTATCAAGGAATTTGCTGAGAAAAACGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues395
Protein Molecular Weight43415.19922
Protein Theoretical pI6.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoserine aminotransferase MSLEREEPQHFGAGPAQMPTPVLQQAAKDLINFNDIGLGIGEISHRSKDATKVIEDSKKH LIELLNIPDTHEVFYLQGGGTTGFSSVATNLAAAYVGKHGKIAPAGYLVTGSWSQKSFEE AKRLHVPAEVIFNAKDYNNGKFGKIPDESLWEDKIKGKAFSYVYLCENETVHGVEWPELP KCLVNDPNIEIVADLSSDILSRKIDVSQYGVIMAGAQKNIGLAGLTLYIIKKSILKNISG ASDETLHELGVPITPIAFDYPTVVKNNSAYNTIPIFTLHVMDLVFQHILKKGGVEAQQAE NEEKAKILYEALDANSDFYNVPVDPKCRSKMNVVFTLKKDGLDDQFLKEAAARHLTGLKG HRSVGGFRASIYNALSVKAVQNLVDFIKEFAEKNA
References
External Links
ResourceLink
Saccharomyces Genome Database SER1
Uniprot IDP33330
Uniprot NameSERC_YEAST
GenBank Gene IDL20917
Genebank Protein ID311153
General Reference
  • Belhumeur, P., Fortin, N., Clark, M. W. (1994). "A gene from Saccharomyces cerevisiae which codes for a protein with significant homology to the bacterial 3-phosphoserine aminotransferase." Yeast 10:385-389.8017107
  • Melcher, K., Rose, M., Kunzler, M., Braus, G. H., Entian, K. D. (1995). "Molecular analysis of the yeast SER1 gene encoding 3-phosphoserine aminotransferase: regulation by general control and serine repression." Curr Genet 27:501-508.7553933
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956