You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoserine aminotransferase
Synonyms
  • PSAT
  • Phosphohydroxythreonine aminotransferase
Gene NameSER1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionCatalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine
Cellular LocationNot Available
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
Vitamin B6 metabolismec00750 Map00750
SMPDB Reactions
Phosphohydroxypyruvic acid + L-Glutamic acidOxoglutaric acid + DL-O-Phosphoserine
KEGG Reactions
L-Glutamic acid + 2-Oxo-3-hydroxy-4-phosphobutanoic acidOxoglutaric acid + O-Phospho-4-hydroxy-L-threonine
Phosphohydroxypyruvic acid + L-Glutamic acidO-Phospho-L-serine + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB00076DL-O-PhosphoserineShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00355O-Phospho-4-hydroxy-L-threonineShow
YMDB003842-Oxo-3-hydroxy-4-phosphobutanoic acidShow
YMDB00393Phosphohydroxypyruvic acidShow
YMDB00761O-Phospho-L-serineShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
serine family amino acid metabolic process
L-serine metabolic process
L-serine biosynthetic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR184W
Gene Sequence>1188 bp ATGTCTTTGGAAAGAGAGGAACCACAACATTTCGGAGCAGGGCCAGCTCAAATGCCTACA CCAGTTTTGCAACAAGCTGCTAAAGACTTAATCAATTTCAATGACATAGGTTTGGGTATC GGTGAAATTTCTCACCGTTCGAAGGATGCCACCAAAGTGATTGAAGACTCTAAGAAGCAC TTAATCGAACTGCTAAATATTCCTGACACTCATGAAGTGTTCTACTTGCAAGGTGGTGGC ACTACTGGTTTTTCTTCCGTTGCTACTAATTTGGCAGCTGCATATGTGGGTAAGCATGGG AAGATTGCACCTGCCGGTTATTTAGTCACCGGTAGTTGGTCTCAGAAATCTTTTGAAGAG GCAAAGAGATTGCACGTTCCTGCTGAAGTTATCTTCAACGCTAAAGATTATAACAATGGC AAATTTGGTAAAATTCCGGATGAATCCCTTTGGGAAGATAAAATCAAAGGTAAGGCTTTC TCATACGTGTACCTATGTGAGAATGAAACTGTTCATGGTGTTGAATGGCCAGAATTACCA AAATGTTTAGTAAACGACCCCAACATCGAAATTGTTGCTGACTTATCCAGCGACATTTTG TCTCGTAAGATTGACGTTTCTCAATACGGTGTCATCATGGCAGGCGCCCAAAAAAACATT GGTTTAGCAGGCTTAACCCTATACATTATCAAGAAATCCATCCTTAAGAATATTTCTGGC GCTTCTGATGAAACATTACATGAATTGGGAGTACCAATCACCCCTATTGCATTCGACTAT CCAACGGTGGTGAAGAACAACTCAGCCTATAATACAATTCCAATTTTCACTTTACATGTT ATGGATCTCGTGTTCCAACATATTTTGAAGAAGGGTGGTGTTGAAGCGCAACAGGCTGAA AATGAAGAAAAGGCCAAGATATTATATGAGGCATTGGATGCAAATTCAGATTTTTACAAC GTTCCAGTGGATCCAAAGTGTAGATCAAAAATGAATGTCGTTTTCACCCTTAAAAAGGAC GGCCTTGATGACCAGTTTCTAAAAGAGGCAGCTGCTCGTCATTTAACCGGTTTGAAAGGA CATCGTTCAGTTGGTGGGTTCAGAGCCTCCATCTATAACGCGCTTTCAGTGAAAGCTGTA CAAAACTTGGTAGATTTTATCAAGGAATTTGCTGAGAAAAACGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues395
Protein Molecular Weight43415.19922
Protein Theoretical pI6.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoserine aminotransferase MSLEREEPQHFGAGPAQMPTPVLQQAAKDLINFNDIGLGIGEISHRSKDATKVIEDSKKH LIELLNIPDTHEVFYLQGGGTTGFSSVATNLAAAYVGKHGKIAPAGYLVTGSWSQKSFEE AKRLHVPAEVIFNAKDYNNGKFGKIPDESLWEDKIKGKAFSYVYLCENETVHGVEWPELP KCLVNDPNIEIVADLSSDILSRKIDVSQYGVIMAGAQKNIGLAGLTLYIIKKSILKNISG ASDETLHELGVPITPIAFDYPTVVKNNSAYNTIPIFTLHVMDLVFQHILKKGGVEAQQAE NEEKAKILYEALDANSDFYNVPVDPKCRSKMNVVFTLKKDGLDDQFLKEAAARHLTGLKG HRSVGGFRASIYNALSVKAVQNLVDFIKEFAEKNA
References
External Links
ResourceLink
Saccharomyces Genome Database SER1
Uniprot IDP33330
Uniprot NameSERC_YEAST
GenBank Gene IDL20917
Genebank Protein ID311153
General Reference
  • Belhumeur, P., Fortin, N., Clark, M. W. (1994). "A gene from Saccharomyces cerevisiae which codes for a protein with significant homology to the bacterial 3-phosphoserine aminotransferase." Yeast 10:385-389.8017107
  • Melcher, K., Rose, M., Kunzler, M., Braus, G. H., Entian, K. D. (1995). "Molecular analysis of the yeast SER1 gene encoding 3-phosphoserine aminotransferase: regulation by general control and serine repression." Curr Genet 27:501-508.7553933
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956