You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name5-amino-6-(5-phosphoribosylamino)uracil reductase
Synonyms
  • HTP reductase
Gene NameRIB7
Enzyme Class
Biological Properties
General FunctionInvolved in 5-amino-6-(5-phosphoribosylamino)uracil reductase activity
Specific Function5-amino-6-(5-phosphoribitylamino)uracil + NADP(+) = 5-amino-6-(5-phosphoribosylamino)uracil + NADPH
Cellular LocationNot Available
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
2,5-Diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate + NADH + hydron2,5-Diamino-6-(1-D-ribitylamino)pyrimidin-4(3H)-one 5'-phosphate + NAD
KEGG Reactions
NADPH + hydron + 2,5-Diamino-4-hydroxy-6-(5-phosphoribosylamino)pyrimidineNADP + 2,5-Diamino-6-(5-phosphono)ribitylamino-4(3H)-pyrimidinone
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB001472,5-Diamino-4-hydroxy-6-(5-phosphoribosylamino)pyrimidineShow
YMDB001635-Amino-6-(5'-phosphoribosylamino)uracilShow
YMDB003005-Amino-6-(5'-phosphoribitylamino)uracilShow
YMDB004242,5-Diamino-6-(5-phosphono)ribitylamino-4(3H)-pyrimidinoneShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB163092,5-Diamino-6-(1-D-ribosylamino)pyrimidin-4(3H)-one 5'-phosphate Show
YMDB163102,5-Diamino-6-(1-D-ribitylamino)pyrimidin-4(3H)-one 5'-phosphate Show
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NADP or NADPH binding
5-amino-6-(5-phosphoribosylamino)uracil reductase activity
catalytic activity
binding
nucleotide binding
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
Process
riboflavin metabolic process
riboflavin biosynthetic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR153W
Gene Sequence>735 bp ATGTCTTTGACACCACTGTGTGAAGATTTACCACAATTTCTGCAAAACTATCTACCGAAT GCTGGTCAAACGGAAAATACCATTGTGCCCTTTGTCACACTAACTTATGCTCAATCGCTC GACGCGAGAGTATCTAGGGGCCCTGGAGTGAGGACTACAATTTCACATCCCGAGACCAAA ACAATGACGCATTATTTGAGACATCATCACGATGGAATACTCGTAGGAAGTGGAACAGTG CTAGCTGATAATCCTGGATTGAATTGTAAATGGGGTCCCGATCCGGCTGCAAATTCCCCA AGGCCAATAATAATAGATACAAAGCAAAAGTGGCGATTTGATGGTTCAAAAATGCAAGAA CTTTTTATTAAACGACAGGGTAAGCCGCCAATCGTTGTTGTCACAAGTGAGCCCATTATA AAAGAACAACATGTAGACTACGCAATTTGTCCAATAAATGATACTACGAAATTGGTCGAT TGGAAGAAATTGTTTGAGATATTAAAAGAAGAATTCAATATAAGGTCAGTAATGGTTGAA GGAGGTGCCAATGTAATAAATCAGTTGTTGCTGAGGAGCGATATTGTCAACAGTCTTATA ATAACTATTGGATCAACATTTCTGGGTAGCTCAGGCACCGAAGTTAGCCCACCCCAAACA GTAAATTTAAAGGATATGTCATGGTGGAAGGGCATTACCGATGTGGTGCTTTGTGCGAGA CTGGCCGATGACTAA
Protein Properties
Pfam Domain Function
Protein Residues244
Protein Molecular Weight27116.0
Protein Theoretical pI6.78
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>5-amino-6-(5-phosphoribosylamino)uracil reductase MSLTPLCEDLPQFLQNYLPNAGQTENTIVPFVTLTYAQSLDARVSRGPGVRTTISHPETK TMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDPAANSPRPIIIDTKQKWRFDGSKMQE LFIKRQGKPPIVVVTSEPIIKEQHVDYAICPINDTTKLVDWKKLFEILKEEFNIRSVMVE GGANVINQLLLRSDIVNSLIITIGSTFLGSSGTEVSPPQTVNLKDMSWWKGITDVVLCAR LADD
References
External Links
ResourceLink
Saccharomyces Genome Database RIB7
Uniprot IDP33312
Uniprot NameRIB7_YEAST
GenBank Gene IDAY557713
Genebank Protein ID45269317
General Reference
  • Baur, A., Schaaff-Gerstenschlager, I., Boles, E., Miosga, T., Rose, M., Zimmermann, F. K. (1993). "Sequence of a 4.8 kb fragment of Saccharomyces cerevisiae chromosome II including three essential open reading frames." Yeast 9:289-293.8488729
  • Baur, A., Schaaff-Gerstenschlager, I., Boles, E., Miosga, T., Rose, M., Zimmermann, F. K. (1994). "Sequence of a 4.8 kb fragment of Saccharomyces cerevisiae chromosome II including three essential open reading frames." Yeast 10:131.8203148
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287