You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidic acid phosphohydrolase 1
Synonyms
  • PAP1
  • Protein SMP2
Gene NamePAH1
Enzyme ClassNot Available
Biological Properties
General Functionvacuole fusion, non-autophagic
Specific FunctionMg(2+)-dependent phosphatidate (PA) phosphatase which catalyzes the dephosphorylation of PA to yield diacylglycerol. Required for de novo lipid synthesis and formation of lipid droplets. Controles transcription of phospholipid biosynthetic genes and nuclear structure by regulating the amount of membrane present at the nuclear envelope. Involved in plasmid maintenance, in respiration and in cell proliferation.
Cellular LocationNot Available
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolismPW002695 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/10:0)PW007514 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/12:0)PW007575 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/14:0)PW007576 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PA(16:0/16:0) + waterDG(16:0/16:0/0:0) + phosphate
PA(10:0/10:0) + water → DG(10:0/10:0/0:0) + phosphate
PA(10:0/12:0) + water → DG(10:0/12:0/0:0) + phosphate
PA(10:0/14:0) + water → DG(10:0/14:0/0:0) + phosphate
PA(10:0/14:1(9Z)) + water → DG(10:0/14:1(9Z)/0:0) + phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
YMDB00907phosphateShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB12737DG(14:0/14:0/0:0)Show
GO Classification
Function
lipid particle organization
phospholipid biosynthetic process
plasmid maintenance
triglyceride biosynthetic process
endoplasmic reticulum membrane
vacuole fusion, non-autophagic
cytosol
positive regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
nuclear membrane
lipid particle
extrinsic component of membrane
vacuole
phosphatidate phosphatase activity
transcription coactivator activity
transcription regulatory region DNA binding
aerobic respiration
fatty acid catabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>2589 bp ATGCAGTACGTAGGCAGAGCTCTTGGGTCTGTGTCTAAAACATGGTCTTCTATCAATCCG GCTACGCTATCAGGTGCTATAGATGTCATTGTAGTGGAGCATCCAGACGGAAGGCTATCA TGTTCTCCCTTTCATGTGAGGTTCGGCAAATTTCAAATTCTAAAGCCATCTCAAAAGAAA GTCCAAGTGTTTATAAATGAGAAACTGAGTAATATGCCAATGAAACTGAGTGATTCTGGA GAAGCCTATTTCGTTTTCGAGATGGGTGACCAGGTCACTGATGTCCCTGACGAATTGCTT GTGTCGCCCGTGATGAGCGCCACATCAAGCCCCCCTCAATCACCTGAAACATCCATCTTA GAAGGAGGAACCGAGGGTGAAGGTGAAGGTGAAAATGAAAATAAGAAGAAGGAAAAGAAA GTGCTAGAGGAACCAGATTTTTTAGATATCAATGACACTGGAGATTCAGGCAGTAAAAAT AGTGAAACTACAGGGTCGCTTTCTCCTACTGAATCCTCTACAACGACACCACCAGATTCA GTTGAAGAGAGGAAGCTTGTTGAGCAGCGTACAAAGAACTTTCAGCAAAAACTAAACAAA AAACTCACTGAAATCCATATACCCAGTAAACTTGATAACAATGGCGACTTACTACTAGAC ACTGAAGGTTACAAGCCAAACAAGAATATGATGCATGACACAGACATACAACTGAAGCAG TTGTTAAAGGACGAATTCGGTAATGATTCAGATATTTCCAGTTTTATCAAGGAGGACAAA AATGGCAACATCAAGATCGTAAATCCTTACGAGCACCTTACTGATTTATCTCCTCCAGGT ACGCCTCCAACAATGGCCACAAGCGGATCAGTTTTAGGCTTAGATGCAATGGAATCAGGA AGTACTTTGAATTCGTTATCTTCTTCACCTTCTGGTTCCGATACTGAGGACGAAACATCA TTTAGCAAAGAACAAAGCAGTAAAAGTGAAAAAACTAGCAAGAAAGGAACAGCAGGGAGC GGTGAGACCGAGAAAAGATACATACGAACGATAAGATTGACTAATGACCAGTTAAAGTGC CTAAATTTAACTTATGGTGAAAATGATCTGAAATTTTCCGTAGATCACGGAAAAGCTATT GTTACGTCAAAATTATTCGTTTGGAGGTGGGATGTTCCAATTGTTATCAGTGATATTGAT GGCACCATCACAAAATCGGACGCTTTAGGCCATGTTCTGGCAATGATAGGAAAAGACTGG ACGCACTTGGGTGTAGCCAAGTTATTTAGCGAGATCTCCAGGAATGGCTATAATATACTC TATCTAACTGCAAGAAGTGCTGGACAAGCTGATTCCACGAGGAGTTATTTGCGATCAATT GAACAGAATGGCAGCAAACTACCAAATGGGCCTGTGATTTTATCACCCGATAGAACGATG GCTGCGTTAAGGCGGGAAGTAATACTAAAAAAACCTGAAGTCTTTAAAATCGCGTGTCTA AACGACATAAGATCCTTGTATTTTGAAGACAGTGATAACGAAGTGGATACAGAGGAAAAA TCAACACCATTTTTTGCCGGCTTTGGTAATAGGATTACTGATGCTTTATCTTACAGAACT GTGGGGATACCTAGTTCAAGAATTTTCACAATAAATACAGAGGGTGAGGTTCATATGGAA TTATTGGAGTTAGCAGGTTACAGAAGCTCCTATATTCATATCAATGAGCTTGTCGATCAT TTCTTTCCACCAGTCAGCCTTGATAGTGTCGATCTAAGAACTAATACTTCCATGGTTCCT GGCTCCCCCCCTAATAGAACGTTGGATAACTTTGACTCAGAAATTACTTCAGGTCGCAAA ACGCTATTTAGAGGCAATCAGGAAGAGAAATTCACAGACGTAAATTTTTGGAGAGACCCG TTAGTCGACATCGACAACTTATCGGATATTAGCAATGATGATTCTGATAACATCGATGAA GATACTGACGTATCACAACAAAGCAACATTAGTAGAAATAGGGCAAATTCAGTCAAAACC GCCAAGGTCACTAAAGCCCCGCAAAGAAATGTGAGCGGCAGCACAAATAACAACGAAGTT TTAGCCGCTTCGTCTGATGTAGAAAATGCGTCTGACCTGGTGAGTTCCCATAGTAGCTCA GGATCCACGCCCAATAAATCTACAATGTCCAAAGGGGACATTGGAAAACAAATATATTTG GAGCTAGGTTCTCCACTTGCATCGCCAAAACTAAGATATTTAGACGATATGGATGATGAA GACTCCAATTACAATAGAACTAAATCAAGGAGAGCATCTTCTGCAGCCGCGACTAGTATC GATAAAGAGTTCAAAAAGCTCTCTGTGTCAAAGGCCGGCGCTCCAACAAGAATTGTTTCA AAGATCAACGTTTCAAATGACGTACATTCACTTGGGAATTCAGATACCGAATCACGAAGG GAGCAAAGTGTTAATGAAACAGGGCGCAATCAGCTACCCCACAACTCAATGGACGATAAA GATTTGGATTCAAGAGTAAGCGATGAATTCGATGACGATGAATTCGACGAAGATGAATTC GAAGATTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues862
Protein Molecular Weight95029.985
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Phosphatidic acid phosphohydrolase 1 MQYVGRALGSVSKTWSSINPATLSGAIDVIVVEHPDGRLSCSPFHVRFGKFQILKPSQKK VQVFINEKLSNMPMKLSDSGEAYFVFEMGDQVTDVPDELLVSPVMSATSSPPQSPETSIL EGGTEGEGEGENENKKKEKKVLEEPDFLDINDTGDSGSKNSETTGSLSPTESSTTTPPDS VEERKLVEQRTKNFQQKLNKKLTEIHIPSKLDNNGDLLLDTEGYKPNKNMMHDTDIQLKQ LLKDEFGNDSDISSFIKEDKNGNIKIVNPYEHLTDLSPPGTPPTMATSGSVLGLDAMESG STLNSLSSSPSGSDTEDETSFSKEQSSKSEKTSKKGTAGSGETEKRYIRTIRLTNDQLKC LNLTYGENDLKFSVDHGKAIVTSKLFVWRWDVPIVISDIDGTITKSDALGHVLAMIGKDW THLGVAKLFSEISRNGYNILYLTARSAGQADSTRSYLRSIEQNGSKLPNGPVILSPDRTM AALRREVILKKPEVFKIACLNDIRSLYFEDSDNEVDTEEKSTPFFAGFGNRITDALSYRT VGIPSSRIFTINTEGEVHMELLELAGYRSSYIHINELVDHFFPPVSLDSVDLRTNTSMVP GSPPNRTLDNFDSEITSGRKTLFRGNQEEKFTDVNFWRDPLVDIDNLSDISNDDSDNIDE DTDVSQQSNISRNRANSVKTAKVTKAPQRNVSGSTNNNEVLAASSDVENASDLVSSHSSS GSTPNKSTMSKGDIGKQIYLELGSPLASPKLRYLDDMDDEDSNYNRTKSRRASSAAATSI DKEFKKLSVSKAGAPTRIVSKINVSNDVHSLGNSDTESRREQSVNETGRNQLPHNSMDDK DLDSRVSDEFDDDEFDEDEFED
References
External Links
ResourceLink
Saccharomyces Genome Database PAH1
Uniprot IDP32567
Uniprot NamePAH1
General ReferenceNot Available