Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyruvate dehydrogenase E1 component subunit beta, mitochondrial
Synonyms
  • Pyruvate dehydrogenase complex component E1 beta
  • PDHE1-B
Gene NamePDB1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionThe pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2)
Cellular LocationMitochondrion matrix
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Butanoate metabolismec00650 Map00650
Citrate cycle (TCA cycle)ec00020 Map00020
Glycolysis / Gluconeogenesisec00010 Map00010
Pyruvate metabolismec00620 Map00620
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB Reactions
Pyruvic acid + Coenzyme A + NADAcetyl-CoA + Carbon dioxide + NADH
Pyruvic acid + Thiamine pyrophosphateCarbon dioxide + 2-(a-Hydroxyethyl)thiamine diphosphate
2-(a-Hydroxyethyl)thiamine diphosphate + Lipoamide-E ↔ Thiamine pyrophosphate + S-Acetyldihydrolipoamide-E
Coenzyme A + S-Acetyldihydrolipoamide-E ↔ Acetyl-CoA + Dihydrolipoamide-E
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00175Pyruvic acidShow
YMDB00312Acetyl-CoAShow
YMDB00381Thiamine pyrophosphateShow
YMDB00912Carbon dioxideShow
YMDB161662-(a-Hydroxyethyl)thiamine diphosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR221C
Gene Sequence>1101 bp ATGTTTTCCAGACTGCCAACATCATTGGCCAGAAATGTTGCACGTCGTGCCCCAACTTCT TTTGTAAGACCCTCTGCAGCAGCAGCAGCATTGAGATTCTCATCAACAAAGACGATGACC GTCAGAGAGGCCTTGAATAGTGCCATGGCGGAAGAATTGGACCGTGATGATGATGTCTTC CTTATTGGTGAAGAAGTTGCACAATATAACGGGGCTTATAAGGTGTCAAAGGGTTTATTG GACAGGTTCGGTGAACGTCGTGTGGTTGACACACCTATTACCGAATACGGGTTCACAGGT TTGGCCGTTGGTGCCGCTTTGAAGGGTTTGAAGCCAATTGTAGAGTTTATGTCGTTCAAT TTCTCTATGCAAGCTATCGATCATGTTGTCAATTCCGCTGCAAAGACTCACTACATGTCT GGTGGTACTCAAAAATGTCAAATGGTCTTCAGAGGTCCTAATGGTGCTGCAGTGGGTGTT GGTGCTCAACATTCACAGGACTTTTCTCCTTGGTACGGTTCCATTCCAGGGTTAAAGGTC CTTGTCCCTTATTCTGCTGAAGATGCTAGGGGTTTGTTAAAGGCCGCCATCAGAGATCCA AACCCTGTTGTATTTTTAGAGAACGAATTGTTGTACGGTGAATCTTTTGAAATCTCAGAA GAAGCTTTATCCCCTGAGTTCACCTTGCCATACAAGGCTAAGATCGAAAGAGAAGGTACC GATATTTCCATTGTTACGTACACAAGAAACGTTCAGTTTTCTTTGGAAGCCGCTGAAATT CTACAAAAGAAATATGGTGTCTCTGCAGAAGTTATCAACTTGCGTTCTATTAGACCTTTA GATACTGAAGCTATCATCAAAACTGTCAAGAAGACAAACCACTTGATTACTGTTGAATCC ACTTTCCCATCATTTGGTGTTGGTGCTGAAATTGTCGCCCAAGTTATGGAGTCTGAAGCC TTTGATTACTTGGATGCTCCAATCCAAAGAGTTACTGGTGCCGATGTTCCAACACCTTAC GCTAAAGAATTAGAAGATTTCGCTTTCCCTGATACTCCAACCATCGTTAAAGCTGTCAAA GAAGTCTTGTCAATTGAATAA
Protein Properties
Pfam Domain Function
Protein Residues366
Protein Molecular Weight40053.19922
Protein Theoretical pI4.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyruvate dehydrogenase E1 component subunit beta, mitochondrial MFSRLPTSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVF LIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFN FSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKV LVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGT DISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVES TFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK EVLSIE
References
External Links
ResourceLink
Saccharomyces Genome Database PDB1
Uniprot IDP32473
Uniprot NameODPB_YEAST
GenBank Gene IDAY692982
Genebank Protein ID51013415
General Reference
  • Miran, S. G., Lawson, J. E., Reed, L. J. (1993). "Characterization of PDH beta 1, the structural gene for the pyruvate dehydrogenase beta subunit from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 90:1252-1256.8433986
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106