You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyruvate carboxylase 2
Synonyms
  • Pyruvic carboxylase 2
  • PCB 2
Gene NamePYC2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionPyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second
Cellular LocationCytoplasm
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Adenosine triphosphate + Pyruvic acid + Hydrogen carbonateADP + phosphate + Oxalacetic acid
KEGG Reactions
Pyruvic acid + Carbonic acid + Adenosine triphosphatephosphate + hydron + Oxalacetic acid + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00175Pyruvic acidShow
YMDB00235Oxalacetic acidShow
YMDB00382Carbonic acidShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB16118Hydrogen carbonateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity
ligase activity, forming carbon-carbon bonds
binding
pyruvate carboxylase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
vitamin binding
biotin binding
catalytic activity
Process
gluconeogenesis
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
metabolic process
hexose metabolic process
glucose metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR218C
Gene Sequence>3543 bp ATGAGCAGTAGCAAGAAATTGGCCGGTCTTAGGGACAATTTCAGTTTGCTCGGCGAAAAG AATAAGATCTTGGTCGCCAATAGAGGTGAAATTCCGATTAGAATTTTTAGATCTGCTCAT GAGCTGTCTATGAGAACCATCGCCATATACTCCCATGAGGACCGTCTTTCAATGCACAGG TTGAAGGCGGACGAAGCGTATGTTATCGGGGAGGAGGGCCAGTATACACCTGTGGGTGCT TACTTGGCAATGGACGAGATCATCGAAATTGCAAAGAAGCATAAGGTGGATTTCATCCAT CCAGGTTATGGGTTCTTGTCTGAAAATTCGGAATTTGCCGACAAAGTAGTGAAGGCCGGT ATCACTTGGATCGGCCCTCCAGCTGAAGTTATTGACTCTGTGGGTGACAAAGTCTCTGCC AGACACTTGGCAGCAAGAGCTAACGTTCCTACCGTTCCCGGTACTCCAGGACCTATCGAA ACTGTGCAAGAGGCACTTGACTTCGTTAATGAATACGGCTACCCGGTGATCATTAAGGCC GCCTTTGGTGGTGGTGGTAGAGGTATGAGAGTCGTTAGAGAAGGTGACGACGTGGCAGAT GCCTTTCAACGTGCTACCTCCGAAGCCCGTACTGCCTTCGGTAATGGTACCTGCTTTGTG GAAAGATTCTTGGACAAGCCAAAGCATATTGAAGTTCAATTGTTGGCTGATAACCACGGA AACGTGGTTCATCTTTTCGAAAGAGACTGTTCTGTGCAAAGAAGACACCAAAAAGTTGTC GAAGTCGCTCCAGCAAAGACTTTGCCCCGTGAAGTTCGTGACGCTATTTTGACAGATGCT GTTAAATTAGCTAAGGTATGTGGTTACAGAAACGCAGGTACCGCCGAATTCTTGGTTGAC AACCAAAACAGACACTATTTCATTGAAATTAATCCAAGAATTCAAGTGGAGCATACCATC ACTGAAGAAATCACCGGTATTGACATTGTTTCTGCCCAAATCCAGATTGCCGCAGGTGCC ACTTTGACTCAACTAGGTCTATTACAGGATAAAATCACCACCCGTGGGTTTTCCATCCAA TGTCGTATTACCACTGAAGATCCCTCTAAGAATTTCCAACCGGATACCGGTCGCCTGGAG GTCTATCGTTCTGCCGGTGGTAATGGTGTGAGATTGGACGGTGGTAACGCTTATGCAGGT GCTACTATCTCGCCTCACTACGACTCAATGCTGGTCAAATGTTCATGCTCTGGTTCTACT TATGAAATCGTCCGTAGGAAGATGATTCGTGCCCTGATCGAATTCAGAATCAGAGGTGTT AAGACCAACATTCCCTTCCTATTGACTCTTTTGACCAATCCAGTTTTTATTGAGGGTACA TACTGGACGACTTTTATTGACGACACCCCACAACTGTTCCAAATGGTATCGTCACAAAAC AGAGCGCAAAAACTGTTACACTATTTGGCAGACTTGGCAGTTAACGGTTCTTCTATTAAG GGTCAAATTGGCTTGCCAAAACTAAAATCAAATCCAAGTGTCCCCCATTTGCACGATGCT CAGGGCAATGTCATCAACGTTACAAAGTCTGCACCACCATCCGGATGGAGACAAGTGCTA CTGGAAAAGGGACCATCTGAATTTGCCAAGCAAGTCAGACAGTTCAATGGTACTCTACTG ATGGACACCACCTGGAGAGACGCTCATCAATCTCTACTTGCAACAAGAGTCAGAACCCAC GATTTGGCTACAATCGCTCCAACAACCGCACATGCCCTTGCAGGTGCTTTCGCTTTAGAA TGTTGGGGTGGTGCTACATTCGACGTTGCAATGAGATTCTTGCATGAGGATCCATGGGAA CGTCTGAGAAAATTAAGATCTCTGGTGCCTAATATTCCATTCCAAATGTTATTACGTGGT GCCAACGGTGTGGCTTACTCTTCATTACCTGACAATGCTATTGACCATTTTGTCAAGCAA GCCAAGGATAATGGTGTTGATATATTTAGAGTTTTTGATGCCTTGAATGATTTAGAACAA TTAAAAGTTGGTGTGAATGCTGTCAAGAAGGCCGGTGGTGTTGTCGAAGCTACTGTTTGT TACTCTGGTGACATGCTTCAGCCAGGTAAGAAATACAACTTAGACTACTACCTAGAAGTT GTTGAAAAAATAGTTCAAATGGGTACACATATCTTGGGTATTAAGGATATGGCAGGTACT ATGAAACCGGCCGCTGCCAAATTATTAATTGGCTCCCTAAGAACCAGATATCCGGATTTA CCAATTCATGTTCACAGTCATGACTCCGCAGGTACTGCTGTTGCGTCTATGACTGCATGT GCCCTAGCAGGTGCTGATGTTGTCGATGTAGCTATCAATTCAATGTCGGGCTTAACTTCC CAACCATCAATTAATGCACTGTTGGCTTCATTAGAAGGTAACATTGATACTGGGATTAAC GTTGAGCATGTTCGTGAATTAGATGCATACTGGGCCGAAATGAGACTGTTGTATTCTTGT TTCGAGGCCGACTTGAAGGGACCAGATCCAGAAGTTTACCAACATGAAATCCCAGGTGGT CAATTGACTAACTTGTTATTCCAAGCTCAACAACTGGGTCTTGGTGAACAATGGGCTGAA ACTAAAAGAGCTTACAGAGAAGCCAATTACCTACTGGGAGATATTGTTAAAGTTACCCCA ACTTCTAAGGTTGTCGGTGATTTAGCTCAATTCATGGTTTCTAACAAACTGACTTCCGAC GATATTAGACGTTTAGCTAATTCTTTGGACTTTCCTGACTCTGTTATGGACTTTTTTGAA GGTTTAATTGGTCAACCATACGGTGGGTTCCCAGAACCATTAAGATCTGATGTATTGAGA AACAAGAGAAGAAAGTTGACGTGCCGTCCAGGTTTAGAATTAGAACCATTTGATCTCGAA AAAATTAGAGAAGACTTGCAGAACAGATTCGGTGATATTGATGAATGCGATGTTGCTTCT TACAATATGTATCCAAGGGTCTATGAAGATTTCCAAAAGATCAGAGAAACATACGGTGAT TTATCAGTTCTACCAACCAAAAATTTCCTAGCACCAGCAGAACCTGATGAAGAAATCGAA GTCACCATCGAACAAGGTAAGACTTTGATTATCAAATTGCAAGCTGTTGGTGACTTAAAT AAGAAAACTGGGCAAAGAGAAGTGTATTTTGAATTGAACGGTGAATTAAGAAAGATCAGA GTTGCAGACAAGTCACAAAACATACAATCTGTTGCTAAACCAAAGGCTGATGTCCACGAT ACTCACCAAATCGGTGCACCAATGGCTGGTGTTATCATAGAAGTTAAAGTACATAAAGGG TCTTTGGTGAAAAAGGGCGAATCGATTGCTGTTTTGAGTGCCATGAAAATGGAAATGGTT GTCTCTTCACCAGCAGATGGTCAAGTTAAAGACGTTTTCATTAAGGATGGTGAAAGTGTT GACGCATCAGATTTGTTGGTTGTCCTAGAAGAAGAAACCCTACCCCCATCCCAAAAAAAG TAA
Protein Properties
Pfam Domain Function
Protein Residues1180
Protein Molecular Weight130166.0
Protein Theoretical pI6.47
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyruvate carboxylase 2 MSSSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHR LKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAG ITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKA AFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVD NQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQ CRITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGST YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN RAQKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVL LEKGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALE CWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ AKDNGVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEV VEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTAC ALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSC FEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTP TSKVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLR NKRRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGD LSVLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIR VADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMV VSSPADGQVKDVFIKDGESVDASDLLVVLEEETLPPSQKK
References
External Links
ResourceLink
Saccharomyces Genome Database PYC2
Uniprot IDP32327
Uniprot NamePYC2_YEAST
GenBank Gene IDU35647
Genebank Protein ID1041735
General Reference
  • Stucka, R., Dequin, S., Salmon, J. M., Gancedo, C. (1991). "DNA sequences in chromosomes II and VII code for pyruvate carboxylase isoenzymes in Saccharomyces cerevisiae: analysis of pyruvate carboxylase-deficient strains." Mol Gen Genet 229:307-315.1921979
  • Val, D. L., Chapman-Smith, A., Walker, M. E., Cronan, J. E. Jr, Wallace, J. C. (1995). "Polymorphism of the yeast pyruvate carboxylase 2 gene and protein: effects on protein biotinylation." Biochem J 312 ( Pt 3):817-825.8554526
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956