You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyrroline-5-carboxylate reductase
Synonyms
  • P5C reductase
  • P5CR
Gene NamePRO3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-proline + NAD(P)(+) = 1-pyrroline-5- carboxylate + NAD(P)H
Cellular LocationNot Available
SMPDB Pathways
Proline MetabolismPW002365 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
1-Pyrroline-5-carboxylic acid + hydron + NADPHNADP + L-Proline
KEGG Reactions
NADH + hydron + 1-pyrroline-3-hydroxy-5-carboxylic acidNAD + trans-4-hydroxy-L-proline
NADPH + hydron + 1-pyrroline-3-hydroxy-5-carboxylic acidNADP + trans-4-hydroxy-L-proline
1-Pyrroline-5-carboxylic acid + NADPH + hydronNADP + L-Proline
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB002431-Pyrroline-5-carboxylic acidShow
YMDB00378L-ProlineShow
YMDB00412NAD(+)Show
YMDB004191-Pyrroline-5-carboxylateShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB007181-pyrroline-3-hydroxy-5-carboxylic acidShow
YMDB00723trans-4-hydroxy-L-prolineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
catalytic activity
pyrroline-5-carboxylate reductase activity
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH group of donors
Process
proline metabolic process
metabolic process
proline biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 5
LocusYER023W
Gene Sequence>861 bp ATGACTTACACATTGGCAATTTTAGGCTGCGGTGTTATGGGCCAAGCACTTCTTTCCGCC ATTTATAATGCTCCAAAGGCGGCTGATGAAACTGCTGCTGCATTTTACCCTTCCAAAATT ATCACATGTAACCATGATGAACCTAGTGCACAACAAGTTACCGATCTAGTTGAGACATTC GACGAATCTCCTAACGGTATTAAAGTCGAAAGCACTTACGGTCACAACGTGAGCGCTGTC GAAGAAGCTTCTGTAGTTCTTCTTGGTACCAAGCCATTTTTGGCCGAAGAAGTGTTGAAT GGTGTGAAGAGCGTCATTGGGGGAAAGCTACTTATTTCCCTGGCTGCTGGCTGGACAATT GACCAATTGAGTCAATACACTAGCACTGTTTGCCGTGTTATGACGAACACACCTGCCAAG TACGGATATGGTTGTGCGGTGGTGTCCTACTCAGCTGATGTTTCCAAAGAGCAAAAGCCA CTGGTCAACGAATTGATTAGCCAAGTTGGTAAATACGTTGAGCTTCCAGAAAAGAACATG GATGCTGCTACGGCTTTAGTCGGTTCAGGCCCCGCTTTTGTTCTCTTGATGTTAGAATCC TTGATGGAGAGTGGGTTGAAATTGGGAATCCCATTACAAGAGAGTAAGGAGTGTGCCATG AAAGTTCTAGAAGGAACAGTGAAGATGGTTGAGAAAAGCGGTGCTCATCCATCCGTTTTA AAGCATCAAGTTTGCACACCAGGTGGTACAACTATTGCCGGGTTGTGCGTAATGGAAGAA AAGGGCGTCAAGAGCGGTATTATCAATGGTGTTGAAGAGGCAGCCCGTGTTGCGTCACAA TTAGGCCAAAAGAAGAAATAG
Protein Properties
Pfam Domain Function
Protein Residues286
Protein Molecular Weight30131.59961
Protein Theoretical pI5.17
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyrroline-5-carboxylate reductase MTYTLAILGCGVMGQALLSAIYNAPKAADETAAAFYPSKIITCNHDEPSAQQVTDLVETF DESPNGIKVESTYGHNVSAVEEASVVLLGTKPFLAEEVLNGVKSVIGGKLLISLAAGWTI DQLSQYTSTVCRVMTNTPAKYGYGCAVVSYSADVSKEQKPLVNELISQVGKYVELPEKNM DAATALVGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVLEGTVKMVEKSGAHPSVL KHQVCTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQLGQKKK
References
External Links
ResourceLink
Saccharomyces Genome Database PRO3
Uniprot IDP32263
Uniprot NameP5CR_YEAST
GenBank Gene IDM57886
Genebank Protein ID172243
General Reference
  • Brandriss, M. C., Falvey, D. A. (1992). "Proline biosynthesis in Saccharomyces cerevisiae: analysis of the PRO3 gene, which encodes delta 1-pyrroline-5-carboxylate reductase." J Bacteriol 174:3782-3788.1592829
  • Brandriss, M. C., Falvey, D. A. (1992). "Proline biosynthesis in Saccharomyces cerevisiae: analysis of the PRO3 gene, which encodes delta 1-pyrroline-5-carboxylate reductase." J Bacteriol 174:5176.1352771
  • Neuville, P., Aigle, M. (1992). "ore2, a mutation affecting proline biosynthesis in the yeast Saccharomyces cerevisiae, leads to a cdc phenotype." Mol Gen Genet 234:193-200.1508147
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956