You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol-3-phosphate dehydrogenase, mitochondrial
Synonyms
  • GPD-M
  • GPDH-M
Gene NameGUT2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific Functionsn-glycerol 3-phosphate + a quinone = glycerone phosphate + a quinol
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB ReactionsNot Available
KEGG Reactions
Glycerol 3-phosphate + FADFADH2 + Dihydroxyacetone phosphate
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00155QuinoneShow
YMDB00296FADShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00597FADH2Show
GO Classification
Component
macromolecular complex
protein complex
glycerol-3-phosphate dehydrogenase complex
Function
catalytic activity
oxidoreductase activity
oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor
glycerol-3-phosphate dehydrogenase activity
oxidoreductase activity, acting on CH-OH group of donors
Process
alditol metabolic process
glycerol metabolic process
metabolic process
glycerol-3-phosphate metabolic process
oxidation reduction
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL155C
Gene Sequence>1950 bp ATGTTTTCGGTAACGAGAAGAAGAGCTGCCGGTGCAGCTGCTGCCATGGCCACAGCCACG GGGACGCTGTACTGGATGACTAGCCAAGGTGATAGGCCGTTAGTGCACAATGACCCGAGC TACATGGTGCAATTCCCCACCGCCGCTCCACCGCAGGTCTCTAGACGAGACCTGCTGGAC CGTCTGGCCAAGACGCATCAATTCGACGTGTTGATCATCGGTGGCGGGGCCACGGGGACA GGATGTGCCCTAGATGCTGCGACCAGGGGACTCAATGTGGCCCTTGTTGAAAAGGGGGAT TTTGCCTCGGGAACGTCGTCCAAATCTACCAAGATGATTCACGGTGGGGTGCGGTACTTA GAGAAGGCCTTCTGGGAGTTCTCCAAGGCACAACTGGATCTGGTCATCGAGGCACTCAAC GAGCGTAAACATCTTATCAACACTGCCCCTCACCTGTGCACGGTGCTACCAATTCTGATC CCCATCTACAGCACCTGGCAGGTCCCGTACATCTATATGGGCTGTAAATTCTACGATTTC TTTGCCGGTTCCCAAAACTTGAAAAAATCATACCTACTGTCCAAATCCGCCACCGTGGAG AAGGCTCCCATGCTTACCACAGACAATTTAAAGGCCTCGCTTGTGTACCATGATGGGTCC TTTAACGACTCGCGTTTGAACGCCACTTTAGCCATCACGGCTGTGGAGAACGGCGCTACC GTCTTGAACTATGTCGAGGTACAAAAATTGATCAAAGACCCAACTTCTGGTAAGGTTATC GGTGCCGAGGCCCGGGACGTTGAGACTAATGAGCTTGTCAGAATCAACGCTAAATGTGTG GTCAATGCCACGGGCCCATACAGTGACGCCATTTTGCAAATGGACCGCAACCCATCCGGT CTGCCGGACTCCCCGCTAAACGACAACTCCAAGATCAAGTCGACTTTCAATCAAATCGCC GTCATGGACCCGAAAATGGTCATCCCATCTATTGGCGTTCACATCGTATTGCCCTCTTTT TACTGCCCGAAGGATATGGGTTTGTTGGACGTCAGAACCTCTGATGGCAGAGTGATGTTC TTTTTACCTTGGCAGGGCAAAGTCCTTGCCGGCACCACAGACATCCCACTAAAGCAAGTC CCAGAAAACCCTATGCCTACAGAGGCTGATATTCAAGATATCTTGAAAGAACTACAGCAC TATATCGAATTCCCCGTGAAAAGAGAAGACGTGCTAAGTGCATGGGCTGGTGTCAGACCT TTGGTCAGAGATCCACGTACAATCCCCGCAGACGGGAAGAAGGGCTCTGCCACTCAGGGC GTGGTAAGATCCCACTTCTTGTTCACTTCGGATAATGGCCTAATTACTATTGCAGGTGGT AAATGGACTACTTACAGACAAATGGCTGAGGAAACAGTCGACAAAGTTGTCGAAGTTGGC GGATTCCACAACCTGAAACCTTGTCACACAAGAGATATTAAGCTTGCTGGTGCAGAAGAA TGGACGCAAAACTATGTGGCTTTATTGGCTCAAAACTACCATTTATCATCAAAAATGTCC AACTACTTGGTTCAAAACTACGGAACCCGTTCCTCTATCATTTGCGAATTTTTCAAAGAA TCCATGGAAAATAAACTGCCTTTGTCCTTAGCCGACAAGGAAAATAACGTAATCTACTCT AGCGAGGAGAACAACTTGGTCAATTTTGATACTTTCAGATATCCATTCACAATCGGTGAG TTAAAGTATTCCATGCAGTACGAATATTGTAGAACTCCCTTGGACTTCCTTTTAAGAAGA ACAAGATTCGCCTTCTTGGACGCCAAGGAAGCTTTGAATGCCGTGCATGCCACCGTCAAA GTTATGGGTGATGAGTTCAATTGGTCGGAGAAAAAGAGGCAGTGGGAACTTGAAAAAACT GTGAACTTCATCAAGACGTTTGGTGTCTAA
Protein Properties
Pfam Domain Function
Protein Residues649
Protein Molecular Weight72388.29688
Protein Theoretical pI8.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycerol-3-phosphate dehydrogenase, mitochondrial MFSVTRRRAAGAAAAMATATGTLYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLD RLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDF FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT VLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSG LPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG GFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR TRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV
References
External Links
ResourceLink
Saccharomyces Genome Database GUT2
Uniprot IDP32191
Uniprot NameGPDM_YEAST
GenBank Gene IDZ38059
Genebank Protein ID557768
General Reference
  • Ronnow, B., Kielland-Brandt, M. C. (1993). "GUT2, a gene for mitochondrial glycerol 3-phosphate dehydrogenase of Saccharomyces cerevisiae." Yeast 9:1121-1130.8256521
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106