You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysyl-tRNA synthetase, mitochondrial
Synonyms
  • Lysine--tRNA ligase
  • LysRS
Gene NameMSK1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-lysine + tRNA(Lys) = AMP + diphosphate + L-lysyl-tRNA(Lys)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Lys) + L-LysineAdenosine monophosphate + Pyrophosphate + Lys-tRNA(Lys)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00330L-LysineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
nucleic acid binding
adenyl nucleotide binding
lysine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
Process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
lysyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL073W
Gene Sequence>1731 bp ATGAATGTGCTGTTAAAAAGACGCAGTTTAACGTTTGCACCGAGATGGCTGTGGTGCAAG TGTCGAAGTAGCAGGAGCAGGCCGTATTCTCTGGCACACGCGGTCGACACAAGTAAGATG GAGGCAACCAGGAGGAACGGTCAGATTGTGAAGGACCTGGGTAGATACTATCCGTCAATG TCAGAATCAGCACTCCACGATCTTTGCCAGGAGTATAAAGAAGTCACTATCGCAGACTTT AATGAGAGATTCTTGGGCAACCCAGCCACATTACACCATGAGGATAATCCTAATTTGTTA CTTAGTATTAATGGCAGGATTAAAAGCATTAGGTTTTCAGGCCAGAAGATTGTTTTTATA GATCTTTACAACGGCAGTAGCGGATTGAAGAATGATACGCAACTGCAGTTGATCGTAAAC TACAATAAAATTGGTGGGAGTAGTGAGGATAAGGCGAATTTCTCAGAATATATGAACTTT TTGAAGAAAGGAGATTATATTAAGGCGCTCGGTTATCCCGGGTTTTCCCAATCCAGAGTC AAGATGCTGTCCTTGATATGTAATAAGCTACCTATAGTATTGTCTGTTTCGCAACTGCCG TTACCTTCCAGACTGAATGATGAAACCAAGATCAAATCTAATAGAGTTGTTGACTACCAA TTAAACGGCACTCAGACACTGCTAGTAAGGGCGCGTATCATCAAACTTTTGAGGAAGTTT CTCGACGACAGAAACTTCGTTGAGGTTGAAACGCCTATACTGTCATCAAAGTCCAACGGT GCCATGGCGAAGCCCTTTATAACGTCGTCCAAGGACTTCGACCATTTGGAGTTGCGTATT GCACCAGAATTATGGCTGAAGAGGCTTATAATTAGTGGTTTACAAAAAGTATACGAAATA GGAAAGGTCTTTCGAAACGAAGGCATTGATTCCACGCATAATGCTGAGTTTTCCACTTTA GAATTCTATGAAACTTACATGTCAATGGACGATATAGTCACAAGGACTGAAGATTTGTTC AAATTTTTGATTACTAACTTGCAAAAGTTCTTTCAAGATACCCGTCTGCCTGTCCCTAAG ACGTTTAGTGAATTACATCTGGCACTATCCGAGAATAATTGGAAGTTTAGAAAAGTCGAA TTCCTGCCCACTTTGAACAAAGAGCTTGGCATTGATCTAATGAACTCTGGATTGGATATC AATAAGCCGAGCGAACTTTTGAAGGCTTTACCGAAAGACATTGCGAAGAAGTATTTTCCT TCTGCAGATAACACTGGGCAATTATCTTCGCTGCAAATCCTAAATAAACTATCGGACGTG TTCCTCGAGCAGCGCCATTGTCAATCAACCTTGCCTACGGTAATATACCATCAACCTGCA ATATTATCGCCCTTAGCCAAGACGGATCCGCAAAATAAGCAAGTCACGAAGAGATTCGAA GTCTTCATCAAAGGTAAGGAATACATCAATGCTTACGAAGAGGAAAATTGCCCCCAATTA CAACTGCAGAAGTTTCTACAACAAAAGCAGATTAACGAATTGACAGGAAACAAAACTGAG ACCTTATCGCCTGTTATTGACTACCAGTATGTTGAGACGATGAAATACGGTATGCCTCCA GTAGGTGGCTTTGGCCTTGGCATAGATAGATTGTGCATGCTATTTTGCGACAAGAAGAGG ATAGAAGAGGTTCTGCCCTTTGGCTGTGTGGATGATGTAAACAGGCAGTAA
Protein Properties
Pfam Domain Function
Protein Residues576
Protein Molecular Weight66127.60156
Protein Theoretical pI9.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Lysyl-tRNA synthetase, mitochondrial MNVLLKRRSLTFAPRWLWCKCRSSRSRPYSLAHAVDTSKMEATRRNGQIVKDLGRYYPSM SESALHDLCQEYKEVTIADFNERFLGNPATLHHEDNPNLLLSINGRIKSIRFSGQKIVFI DLYNGSSGLKNDTQLQLIVNYNKIGGSSEDKANFSEYMNFLKKGDYIKALGYPGFSQSRV KMLSLICNKLPIVLSVSQLPLPSRLNDETKIKSNRVVDYQLNGTQTLLVRARIIKLLRKF LDDRNFVEVETPILSSKSNGAMAKPFITSSKDFDHLELRIAPELWLKRLIISGLQKVYEI GKVFRNEGIDSTHNAEFSTLEFYETYMSMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPK TFSELHLALSENNWKFRKVEFLPTLNKELGIDLMNSGLDINKPSELLKALPKDIAKKYFP SADNTGQLSSLQILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFE VFIKGKEYINAYEEENCPQLQLQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPP VGGFGLGIDRLCMLFCDKKRIEEVLPFGCVDDVNRQ
References
External Links
ResourceLink
Saccharomyces Genome Database MSK1
Uniprot IDP32048
Uniprot NameSYKM_YEAST
GenBank Gene IDX57360
Genebank Protein ID450763
General Reference
  • Gatti, D. L., Tzagoloff, A. (1991). "Structure and evolution of a group of related aminoacyl-tRNA synthetases." J Mol Biol 218:557-568.2016746
  • Pohlmann, R., Philippsen, P. (1996). "Sequencing a cosmid clone of Saccharomyces cerevisiae chromosome XIV reveals 12 new open reading frames (ORFs) and an ancient duplication of six ORFs." Yeast 12:391-402.8701611
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956