You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMalate synthase 1, glyoxysomal
SynonymsNot Available
Gene NameMLS1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionThis isozyme is necessary for growth on acetate as sole C-source
Cellular LocationGlyoxysome
SMPDB Pathways
Glyoxylate cyclePW002419 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glyoxylate and dicarboxylate metabolismec00630 Map00630
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Glyoxylic acid + Acetyl-CoA + waterCoenzyme A + hydron + (S)-Malic acid
KEGG Reactions
Glyoxylic acid + Acetyl-CoA + waterhydron + Coenzyme A + (S)-malate(2-)
Metabolites
YMDB IDNameView
YMDB00033Glyoxylic acidShow
YMDB00045Coenzyme AShow
YMDB00280(S)-Malic acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
malate synthase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Process
cellular carbohydrate metabolic process
glyoxylate cycle
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL117W
Gene Sequence>1665 bp ATGGTTAAGGTCAGTTTGGATAACGTCAAATTACTGGTGGATGTTGATAAGGAGCCTTTC TTTAAACCATCTAGTACTACAGTGGGAGATATTCTTACCAAGGATGCTCTAGAGTTCATT GTTCTTTTACACAGAACTTTCAACAACAAGAGAAAACAATTATTGGAAAACAGACAAGTT GTTCAGAAGAAATTAGACTCGGGCTCCTATCATCTGGATTTCCTGCCTGAAACTGCAAAT ATTAGAAATGATCCCACTTGGCAAGGTCCAATTTTGGCACCGGGGTTAATTAATAGGTCA ACGGAAATCACAGGGCCTCCATTGAGAAATATGCTGATCAACGCTTTGAATGCTCCTGTG AACACCTATATGACTGATTTTGAAGATTCAGCTTCACCTACTTGGAACAACATGGTTTAC GGTCAAGTTAATCTCTACGACGCGATCAGAAATCAAATCGATTTTGACACACCAAGAAAA TCGTACAAATTGAATGGAAATGTGGCCAACTTGCCCACTATTATCGTGAGACCCCGTGGT TGGCACATGGTGGAAAAGCACCTTTATGTAGATGATGAACCAATCAGCGCTTCCATCTTT GATTTTGGTTTATATTTCTACCATAATGCCAAAGAATTAATCAAATTGGGCAAAGGTCCT TACTTCTATTTGCCAAAGATGGAGCACCACTTGGAAGCTAAACTATGGAACGACGTCTTC TGTGTAGCTCAAGATTACATTGGGATCCCAAGGGGTACAATCAGAGCTACTGTGTTGATT GAAACTTTGCCTGCTGCTTTCCAAATGGAAGAGATCATCTATCAATTAAGACAACATTCT AGTGGGTTGAATTGCGGACGTTGGGACTATATTTTCTCTACAATCAAGAGATTAAGAAAT GATCCTAATCACATTTTGCCCAATAGAAATCAAGTGACTATGACTTCCCCATTCATGGAT GCATACGTGAAAAGATTAATCAATACCTGTCATCGGAGGGGTGTTCATGCCATGGGTGGT ATGGCTGCGCAAATCCCTATCAAAGACGACCCGGCAGCCAATGAAAAGGCCATGACTAAA GTCCGTAATGATAAGATTAGAGAGCTGACAAATGGACATGATGGGTCATGGGTTGCACAC CCAGCACTGGCCCCTATTTGTAATGAAGTTTTCATTAATATGGGAACACCAAACCAAATC TATTTCATTCCTGAAAACGTTGTAACGGCTGCTAATCTGCTGGAAACCAAAATTCCAAAT GGTGAGATTACTACCGAGGGAATTGTACAAAACTTGGATATCGGGTTGCAGTACATGGAA GCTTGGCTCAGAGGCTCTGGATGTGTGCCCATCAACAACTTGATGGAAGACGCCGCCACT GCTGAAGTGTCTCGTTGTCAATTGTATCAATGGGTGAAACACGGTGTTACTCTAAAGGAC ACGGGAGAAAAGGTCACCCCAGAATTAACCGAAAAGATTCTAAAAGAACAAGTGGAAAGA CTGTCTAAGGCAAGTCCATTGGGTGACAAGAACAAATTCGCGCTGGCCGCTAAGTATTTC TTGCCAGAAATCAGAGGCGAGAAATTCAGTGAATTTTTGACTACATTGTTGTACGACGAA ATTGTGTCCACTAAGGCGACGCCCACTGATTTGAGCAAATTGTGA
Protein Properties
Pfam Domain Function
Protein Residues554
Protein Molecular Weight62790.60156
Protein Theoretical pI7.2
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Malate synthase 1, glyoxysomal MVKVSLDNVKLLVDVDKEPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQV VQKKLDSGSYHLDFLPETANIRNDPTWQGPILAPGLINRSTEITGPPLRNMLINALNAPV NTYMTDFEDSASPTWNNMVYGQVNLYDAIRNQIDFDTPRKSYKLNGNVANLPTIIVRPRG WHMVEKHLYVDDEPISASIFDFGLYFYHNAKELIKLGKGPYFYLPKMEHHLEAKLWNDVF CVAQDYIGIPRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRN DPNHILPNRNQVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPAANEKAMTK VRNDKIRELTNGHDGSWVAHPALAPICNEVFINMGTPNQIYFIPENVVTAANLLETKIPN GEITTEGIVQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLYQWVKHGVTLKD TGEKVTPELTEKILKEQVERLSKASPLGDKNKFALAAKYFLPEIRGEKFSEFLTTLLYDE IVSTKATPTDLSKL
References
External Links
ResourceLink
Saccharomyces Genome Database MLS1
Uniprot IDP30952
Uniprot NameMASY_YEAST
GenBank Gene IDEF125216
Genebank Protein ID125863488
General Reference
  • Hartig, A., Simon, M. M., Schuster, T., Daugherty, J. R., Yoo, H. S., Cooper, T. G. (1992). "Differentially regulated malate synthase genes participate in carbon and nitrogen metabolism of S. cerevisiae." Nucleic Acids Res 20:5677-5686.1454530
  • Sinha, H., David, L., Pascon, R. C., Clauder-Munster, S., Krishnakumar, S., Nguyen, M., Shi, G., Dean, J., Davis, R. W., Oefner, P. J., McCusker, J. H., Steinmetz, L. M. (2008). "Sequential elimination of major-effect contributors identifies additional quantitative trait loci conditioning high-temperature growth in yeast." Genetics 180:1661-1670.18780730
  • De Antoni, A., D'Angelo, M., Dal Pero, F., Sartorello, F., Pandolfo, D., Pallavicini, A., Lanfranchi, G., Valle, G. (1997). "The DNA sequence of cosmid 14-13b from chromosome XIV of Saccharomyces cerevisiae reveals an unusually high number of overlapping open reading frames." Yeast 13:261-266.9090055
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Fay, J. C., Benavides, J. A. (2005). "Evidence for domesticated and wild populations of Saccharomyces cerevisiae." PLoS Genet 1:66-71.16103919