You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSqualene synthase
Synonyms
  • SQS
  • SS
  • FPP:FPP farnesyltransferase
  • Farnesyl-diphosphate farnesyltransferase
Gene NameERG9
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity
Specific FunctionMay regulate the flux of isoprene intermediates through the sterol pathway. Squalene synthase is crucial for balancing the incorporation of farnesyl diphosphate (FPP) into sterol and nonsterol isoprene synthesis. ERG9 is also essential for cell growth in yeast
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
Farnesyl pyrophosphate + NADPHsqualene + NADP + Pyrophosphate
KEGG Reactions
2-trans,6-trans-farnesyl diphosphate + NADPH + hydronNADP + squalene + Pyrophosphate
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00229Farnesyl pyrophosphateShow
YMDB003252-trans,6-trans-farnesyl diphosphateShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00769squaleneShow
YMDB00843presqualene diphosphateShow
YMDB00862hydronShow
GO Classification
Component
integral to membrane
cell part
membrane part
intrinsic to membrane
Function
transferase activity, transferring alkyl or aryl (other than methyl) groups
catalytic activity
transferase activity
prenyltransferase activity
farnesyltranstransferase activity
farnesyl-diphosphate farnesyltransferase activity
Process
biosynthetic process
primary metabolic process
lipid metabolic process
lipid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR190W
Gene Sequence>1335 bp ATGGGAAAGCTATTACAATTGGCATTGCATCCGGTCGAGATGAAGGCAGCTTTGAAGCTG AAGTTTTGCAGAACACCGCTATTCTCCATCTATGATCAGTCCACGTCTCCATATCTCTTG CACTGTTTCGAACTGTTGAACTTGACCTCCAGATCGTTTGCTGCTGTGATCAGAGAGCTG CATCCAGAATTGAGAAACTGTGTTACTCTCTTTTATTTGATTTTAAGGGCTTTGGATACC ATCGAAGACGATATGTCCATCGAACACGATTTGAAAATTGACTTGTTGCGTCACTTCCAC GAGAAATTGTTGTTAACTAAATGGAGTTTCGACGGAAATGCCCCCGATGTGAAGGACAGA GCCGTTTTGACAGATTTCGAATCGATTCTTATTGAATTCCACAAATTGAAACCAGAATAT CAAGAAGTCATCAAGGAGATCACCGAGAAAATGGGTAATGGTATGGCCGACTACATCTTG GATGAAAATTACAACTTGAATGGGTTGCAAACCGTCCACGACTACGACGTGTACTGTCAC TACGTAGCTGGTTTGGTCGGTGATGGTTTGACCCGTTTGATTGTCATTGCCAAGTTTGCC AACGAATCTTTGTATTCTAATGAGCAATTGTATGAAAGCATGGGTCTTTTCCTACAAAAA ACCAACATCATCAGAGACTACAATGAAGATTTGGTCGATGGTAGATCCTTCTGGCCCAAG GAAATCTGGTCACAATACGCTCCTCAGTTGAAGGACTTCATGAAACCTGAAAACGAACAA CTGGGGTTGGACTGTATAAACCACCTCGTCTTAAACGCATTGAGTCATGTTATCGATGTG TTGACTTATTTGGCCAGTATCCACGAGCAATCCACTTTCCAATTTTGTGCCATTCCCCAA GTTATGGCCATTGCAACCTTGGCTTTGGTATTCAACAACCGTGAAGTGCTACATGGCAAT GTAAAGATTCGTAAGGGTACTACCTGCTATTTAATTTTGAAATCAAGGACTTTGCGTGGC TGTGTCGAGATTTTTGACTATTACTTACGTGATATCAAATCTAAATTGGCTGTGCAAGAT CCAAATTTCTTAAAATTGAACATTCAAATCTCCAAGATCGAACAATTCATGGAAGAAATG TACCAGGATAAATTACCTCCTAACGTGAAGCCAAATGAAACTCCAATTTTCTTGAAAGTT AAAGAAAGATCCAGATACGATGATGAATTGGTCCCAACCCAACAAGAAGAAGAGTACAAG TTCAATATGGTTTTATCTATCATCTTGTCCGTTCTTCTTGGGTTTTATTATATATACACT TTACACAGAGCGTGA
Protein Properties
Pfam Domain Function
Protein Residues444
Protein Molecular Weight51719.39844
Protein Theoretical pI5.75
Signalling Regions
  • None
Transmembrane Regions
  • 291-311
  • 421-441
Protein Sequence>Squalene synthase MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIREL HPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDR AVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCH YVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPK EIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQ VMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQD PNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYK FNMVLSIILSVLLGFYYIYTLHRA
References
External Links
ResourceLink
Saccharomyces Genome Database ERG9
Uniprot IDP29704
Uniprot NameFDFT_YEAST
GenBank Gene IDM63979
Genebank Protein ID171481
General Reference
  • Fegueur, M., Richard, L., Charles, A. D., Karst, F. (1991). "Isolation and primary structure of the ERG9 gene of Saccharomyces cerevisiae encoding squalene synthetase." Curr Genet 20:365-372.1807826
  • Jennings, S. M., Tsay, Y. H., Fisch, T. M., Robinson, G. W. (1991). "Molecular cloning and characterization of the yeast gene for squalene synthetase." Proc Natl Acad Sci U S A 88:6038-6042.2068081
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106