Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized protein YKL215C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionNot Available
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00107Pyroglutamic acidShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
hydrolase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome LocationNot Available
LocusYKL215C
Gene Sequence>3861 bp ATGCAGAAAGGAAACATAAGAATTGCCATCGATAAGGGTGGAACTTTCACTGATTGTGTG GGGAATATTGGTACAGGTAAACAAGAACATGATACTGTCATCAAGCTCTTGTCGGTGGAT CCCAAAAACTATCCAGATGCTCCCCTTGAAGGCATAAGACGTCTCTTGGAGGTGCTTGAA CACAAGACAATTCCTCGCGGTATTCCTCTAGACATCTCTAATGTGAGAAGTTTAAGAATG GGGACAACCCTAGCTACAAACTGCGCTCTAGAAAGAAATGGTGAACGTTGTGCCTTCATT ACTACGAAAGGCTTTAAGGATTCATTGCTGATTGGAGACCAAACCAGGCCAGATATCTTC AACTTAAATATAAAAAAGGTAGTGCCATTATATGACACTGTAGTTGAAATAGATGAGAGA GTTACTTTAGAAGATTTCTCGGAAGACCCTTATTTTACCAAATCGTCTCCTAATGAACAA GAAGGTATCCTGGAAGGTAATAGTGGCGAAATGGTAAGGGTCATAAAGAAGCCAGATGAA TCAAGCGTAAGATCTATTCTGAAAGTGCTTTATGCTAGCGGAATCAAGTCTATTGCGATA GCATTTTTACACTCATACACTTTTCCAGACCATGAGCGAATTGTTGGTAATATTGCCAGG GAGATTGGGTTTTCTCATGTTTCATTATCATCTGAAGTCTCTCCAATGATAAAATTTTTA CCGAGGGCTCACAGTTCTGTCGCAGATGCCTACCTTACTCCGGTAATTAAAAAGTACTTG AATAGCATTTCTGCAGGTTTGAGCCACGCAGAAGATACCCACATTCAATTCATGCAGTCT GATGGTGGTTTAGTGGATGGGGGAAAATTTTCCGGTTTGAAATCTATTTTATCTGGTCCT GCAGGTGGCGTAATAGGTTATTCTAGTACATGCTATGATAAAAATAATAACATACCCTTA ATAGGCTTTGACATGGGAGGAACATCTACTGATGTCAGTAGGTACGGCGATGGGAGGTTA GAACATGTTTTTGAAACTGTTACCGCAGGGATCATCATACAATCTCCTCAACTTGACATC CATACTGTTGCTGCTGGAGGAAGTTCTATTTTGTCATGGAAAAACGGGTTATTCAGAGTA GGCCCTGATTCAGCAGCTGCTGATCCAGGCCCTGCAGCCTACAGAAAGGGCGGGCCTTTG ACCATTACAGACGCCAACCTCTTTTTAGGACGTTTGGTTCCTGAGTTCTTCCCCAAAATT TTTGGGCCCAATGAGGATGAATCACTTGACTTAGAAACCACTACTTTGAAATTCAGAGAA TTAACAGATGTCATCAATAAGGATCTGAATTCAAATCTAACCATGGAAGAGGTTGCCTAT GGATTTATCAAAGTAGCTAACGAATGCATGGCAAGACCTGTGAGGGCCATTACAGAAGCA AAAGGACATGTAGTATCTCAGCATCGGTTAGTTTCCTTTGGCGGGGCTGGCGGGCAACAC GCCATAGCGGTTGCAGATTCATTGGGCATTGACACTGTTTTAATTCATAGATATTCTTCT ATCTTGTCCGCTTATGGCATTTTCTTAGCAGATGTTATTGAAGAAAACCAAGAGCCTTGC TCTTTTATCTTGGGTGAGCCAGAGACCATCTTGAAAGTGAAAAAAAGATTCTTAGAACTT TCTAAAAATTCAATCAAAAACCTTTTATCTCAGTCGTTTTCTCGGGAGGACATAGTCTTG GAAAGATATTTAAATCTCAGATATGAAGGTACTGAAACCAGTTTGATGATATTACAAAAA TATGATGACCAATGGAATTTTAGGGAATGGTTCTCTGAAGCTCATAAAAAAGAGTTCGGA TTCTCATTCGATGACAAACGAATTATAATTGATGATATAAGGATAAGAGCAATTGGGAAA TCAGGCGTTAGAAAAGAAAAAACGGTTGATGAGCAATTGATTGAAATTTCCCATTTCAAG AAAGCCGACGTGTCAAAGGATGCTAGTTTTACCCAGAAAGCATATTTTGACAACAAATGG GTCGACACTGCGGTCTTCAAAATTGATGATCTTCCTGCCGGAACAATTATCGAGGGCCCA GCCATATTGGCTGACGGTACCCAAACAAATATTATTTTACCAAACAGCCAAGCAACAATT TTAAACTCTCATATATTTATCAAGATCAACCAAAAGGCTGCGAAGACATTATCTAAAAGC GGATATGAACTTGATATAGATCCAATCTTATTGTCTATTTTCAGTCATAGGTTTATGGAT ATCGCCCTCCAGATGGGTACTCAATTGAGGAAAACTTCTGTTTCAACTAACGTCAAAGAG AGATTAGATTTTTCATGTGCACTATTCGACTCTAAAGGAAACTTAGTCGCTAACGCTCCT CATGTACCTGTTCACTTAGGATCAATGTCAACCTGCATATCAGCACAGGCGAAGTTATGG GAAGGCAAATTAAAGCCTGGTGATGTTTTAATCACAAACCATCCGGATATTGGTGGTACT CATTTACCAGACATAACAGTAATAACTCCTTCTTTCTCTTCAACTGGCGAATTGATATTT TATGTGGCTTCAAGAGCCCATCATGCAGATATTGGAGGTATTCTACCCGGTTCAGTGCCT CCAAATTCCAAAGAATTGTACGAAGAAGGAACCGCAATTTATTCCGAATTGGTTGTCAAA GAGGGAATTTTCCAGGAAGAATTAATTTACAAGCTTTTCGTAGAAGATCCAGGCAAATAC CCAGGCTGCTCAGGTTCAAGAAGATTTAGTGATAACATAAGCGATTTAAAAGCGCAAGTC GCAGCTAACACAAAAGGGATACAGTTAATTGGGTCATTAACTAAGGAATATGATCTGGCT ACAATATTGAAATACATGGCTGCAATTCAGACAAATGCATCTGAATCCATAAAAAAAATG CTTGCAAAAATGGTTGAACATTTTGGCACAACGAAGTTTTCTGGCGAAGATCGCTTAGAT GATGGAAGCTTAATTAAACTACAAGTTATCATAAGACCTGAAAAAGAGGAGTATATTTTT AATTTCGATGGCACTTCTCCCCAAGTTTATGGTAATTTAAATGCACCAGAGGCTATTACT AATTCTGCGATTCTTTATTGTCTACGGTGTCTAGTAGGCGAAGATATTCCTTTAAATCAA GGTTGTTTAAAACCCTTAACAATAAAAATTCCTGCTGGTTCCCTCTTGAGCCCCCGATCC GGTGCTGCTGTTGTCGGAGGCAATGTATTAACTTCCCAAAGAGTGACAGATGTAATCTTA AAAACATTTAACGTCATGGCAGATTCTCAAGGTGACTGTAACAACTTTACATTTGGAACT GGAGGAAATTCTGGTAACAAAACCGATAAGCAGATCAAAGGCTTTGGATATTATGAAACC ATATGTGGCGGCTCGGGGGCTGGTGCAGATTCATGGAGAGGAAGTGGTTGGAATGGCTCA GACGCTGTACACACGAATATGACCAATACAAGAATGACAGATACTGAGGTATTTGAAAGG AGATACCCCGTTCTGTTGAAAGAGTTCTCGATCAGAAGAGGTTCAGGAGGCAAAGGTAAA TATACTGGCGGAAATGGCGTAGTAAGGGATGTTCAATTTCGGAAGGCTGTAACAGCATCT ATATTATCAGAACGTCGTGTCATTGGCCCTCATGGTATAAAGGGAGGACAAGACGGTAGT AGAGGTGAGAATTTATGGGTAAGACATAGCACAGGCGCATTAATCAATGTCGGCGGTAAA AATACGATTTACGCTCAACCCGGTGATCGATTCATCATTAAAACCCCTGGTGGTGGGGGA TTTGGACAATACAAGGATTAA
Protein Properties
Pfam Domain Function
Protein Residues1286
Protein Molecular Weight140426.0
Protein Theoretical pI6.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uncharacterized protein YKL215C MQKGNIRIAIDKGGTFTDCVGNIGTGKQEHDTVIKLLSVDPKNYPDAPLEGIRRLLEVLE HKTIPRGIPLDISNVRSLRMGTTLATNCALERNGERCAFITTKGFKDSLLIGDQTRPDIF NLNIKKVVPLYDTVVEIDERVTLEDFSEDPYFTKSSPNEQEGILEGNSGEMVRVIKKPDE SSVRSILKVLYASGIKSIAIAFLHSYTFPDHERIVGNIAREIGFSHVSLSSEVSPMIKFL PRAHSSVADAYLTPVIKKYLNSISAGLSHAEDTHIQFMQSDGGLVDGGKFSGLKSILSGP AGGVIGYSSTCYDKNNNIPLIGFDMGGTSTDVSRYGDGRLEHVFETVTAGIIIQSPQLDI HTVAAGGSSILSWKNGLFRVGPDSAAADPGPAAYRKGGPLTITDANLFLGRLVPEFFPKI FGPNEDESLDLETTTLKFRELTDVINKDLNSNLTMEEVAYGFIKVANECMARPVRAITEA KGHVVSQHRLVSFGGAGGQHAIAVADSLGIDTVLIHRYSSILSAYGIFLADVIEENQEPC SFILGEPETILKVKKRFLELSKNSIKNLLSQSFSREDIVLERYLNLRYEGTETSLMILQK YDDQWNFREWFSEAHKKEFGFSFDDKRIIIDDIRIRAIGKSGVRKEKTVDEQLIEISHFK KADVSKDASFTQKAYFDNKWVDTAVFKIDDLPAGTIIEGPAILADGTQTNIILPNSQATI LNSHIFIKINQKAAKTLSKSGYELDIDPILLSIFSHRFMDIALQMGTQLRKTSVSTNVKE RLDFSCALFDSKGNLVANAPHVPVHLGSMSTCISAQAKLWEGKLKPGDVLITNHPDIGGT HLPDITVITPSFSSTGELIFYVASRAHHADIGGILPGSVPPNSKELYEEGTAIYSELVVK EGIFQEELIYKLFVEDPGKYPGCSGSRRFSDNISDLKAQVAANTKGIQLIGSLTKEYDLA TILKYMAAIQTNASESIKKMLAKMVEHFGTTKFSGEDRLDDGSLIKLQVIIRPEKEEYIF NFDGTSPQVYGNLNAPEAITNSAILYCLRCLVGEDIPLNQGCLKPLTIKIPAGSLLSPRS GAAVVGGNVLTSQRVTDVILKTFNVMADSQGDCNNFTFGTGGNSGNKTDKQIKGFGYYET ICGGSGAGADSWRGSGWNGSDAVHTNMTNTRMTDTEVFERRYPVLLKEFSIRRGSGGKGK YTGGNGVVRDVQFRKAVTASILSERRVIGPHGIKGGQDGSRGENLWVRHSTGALINVGGK NTIYAQPGDRFIIKTPGGGGFGQYKD
References
External Links
ResourceLink
Saccharomyces Genome Database YKL215C
Uniprot IDP28273
Uniprot NameYKV5_YEAST
GenBank Gene IDX75951
Genebank Protein ID473135
General Reference
  • Tzermia, M., Horaitis, O., Alexandraki, D. (1994). "The complete sequencing of a 24.6 kb segment of yeast chromosome XI identified the known loci URA1, SAC1 and TRP3, and revealed 6 new open reading frames including homologues to the threonine dehydratases, membrane transporters, hydantoinases and the phospholipase A2-activating protein." Yeast 10:663-679.7941750
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Roy, A. (1992). "Nucleotide sequence of the URA1 gene of Saccharomyces cerevisiae." Gene 118:149-150.1511880
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956