You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArgininosuccinate synthase
Synonyms
  • Citrulline--aspartate ligase
Gene NameARG1
Enzyme Class
Biological Properties
General FunctionInvolved in argininosuccinate synthase activity
Specific FunctionIn yeast, as can have a catabolic function since it allows efficient utilization of citrulline via arginine and the reactions involved in the arginase pathway
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
Adenosine triphosphate + Citrulline + L-Aspartic acidPyrophosphate + Adenosine monophosphate + Argininosuccinic acid
KEGG Reactions
L-Aspartic acid + Adenosine triphosphate + CitrullineAdenosine monophosphate + Pyrophosphate + Argininosuccinic acid + hydron
Metabolites
YMDB IDNameView
YMDB00052Argininosuccinic acidShow
YMDB00060CitrullineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00593(N(omega)-L-arginino)succinic acidShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
Not Available
Function
argininosuccinate synthase activity
binding
nucleoside binding
catalytic activity
purine nucleoside binding
adenyl nucleotide binding
ligase activity
adenyl ribonucleotide binding
ligase activity, forming carbon-nitrogen bonds
ATP binding
Process
arginine biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
metabolic process
arginine metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL058W
Gene Sequence>1263 bp ATGTCTAAGGGAAAAGTTTGTTTGGCTTATTCTGGTGGTTTAGATACCTCCGTCATTTTG GCTTGGCTACTAGACCAGGCTACGGAAGTTGTAGCTTTCATGGCTAATGTAGGGCAAGAA GAAGATTTCGATGCCGCCAAGGTTTTGGCCTTGAAGATCGGTGCCTGCAAGTTCGTTTGT GGTGGATTGTCTGAAGATTTTGTCAAGGATATTCTATTCCCAGCTGTACAGGTCAACGCT GTGTACGAAGACGTTTATCTGTTGGGTACCTCTTTGGCAAGACCTGTTATTGCCAAAGCC CAAATTGACGTCGCTAAACAGGAGGGCTGTTTCGCGGTCTCTCATGGTTGTACCGGCAAA GGTAATGATCAAATCAGATTCGAATTGTCATTTTACGCTCTGAAGCCAGACGTTAAGTGT ATTACACCATGGAGAATGCCTGAATTTTTCGAAAGATTTGCTGGCAGAAAGGATTTGTTA GACTATGCTGCACAAAAGGGTATTTTTGTCGCCCAAACCAAGGCCAAGCCATGGTCTACT GACGAAAACCAAGCCCACATTTCTTACGAGGCAGGTATCTTGGAAGACCCAGATACCACC CCACCAAAGGACATGTGGAAATTGATCGTCGATCCAATGGATGCTCCGGACCAACCACAA GATTTGACCATTGACTTTGAACGTGGTCTTCCAGTCAAGTTGACCTACACCGACAACAAG ACTTCCAAGGAAGTTTCCGTTACCAAGCCTTTGGATGTTTTCTTGGCCGCATCCAACTTA GCAAGGGCCAACGGTGTTGGTAGAATCGATATTGTAGAAGATCGTTACATTAACTTGAAA TCCAGAGGTTGTTACGAACAGGCTCCATTGACTGTTTTGAGAAAAGCTCATGTTGATTTG GAAGGTTTGACTTTAGACAAAGAAGTCCGTCAATTGAGAGACTCATTGGTCACTCCAAAC TACTCCAGATTGATATATAACGGTTTCCTACTTCACCCAGAGTGTGAGTACATCAGATCT ATGATCCAACCATCCCAAAATAGCGTTAACGGTACTGTCAGGGTTAGACTGTATAAGGGT AACGTCATCATTCTGGGCAGATCTACAAAGACTGAAAAGTTGTACGATCCGACAGAATCC TCTATGGATGAGTTGACCGGTTTCTTACCTACCGATACCACCGGTTTCATTGCCATCCAG GCCATTAGAATTAAAAAATACGGTGAATCCAAAAAAACCAAAGGTGAAGAGTTGACTTTG TAA
Protein Properties
Pfam Domain Function
Protein Residues420
Protein Molecular Weight46939.30078
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Argininosuccinate synthase MSKGKVCLAYSGGLDTSVILAWLLDQGYEVVAFMANVGQEEDFDAAKEKALKIGACKFVC VDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGK GNDQIRFELSFYALKPDVKCITPWRMPEFFERFAGRKDLLDYAAQKGIPVAQTKAKPWST DENQAHISYEAGILEDPDTTPPKDMWKLIVDPMDAPDQPQDLTIDFERGLPVKLTYTDNK TSKEVSVTKPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDL EGLTLDKEVRQLRDSFVTPNYSRLIYNGFLLHPECEYIRSMIQPSQNSVNGTVRVRLYKG NVIILGRSTKTEKLYDPTESSMDELTGFLPTDTTGFIAIQAIRIKKYGESKKTKGEELTL
References
External Links
ResourceLink
Saccharomyces Genome Database ARG1
Uniprot IDP22768
Uniprot NameASSY_YEAST
GenBank Gene IDM35237
Genebank Protein ID171085
General Reference
  • Van Vliet, F., Crabeel, M., Boyen, A., Tricot, C., Stalon, V., Falmagne, P., Nakamura, Y., Baumberg, S., Glansdorff, N. (1990). "Sequences of the genes encoding argininosuccinate synthetase in Escherichia coli and Saccharomyces cerevisiae: comparison with methanogenic archaebacteria and mammals." Gene 95:99-104.2123815
  • Mannhaupt, G., Vetter, I., Schwarzlose, C., Mitzel, S., Feldmann, H. (1996). "Analysis of a 26 kb region on the left arm of yeast chromosome XV." Yeast 12:67-76.8789261
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Crabeel, M., Seneca, S., Devos, K., Glansdorff, N. (1988). "Arginine repression of the Saccharomyces cerevisiae ARG1 gene. Comparison of the ARG1 and ARG3 control regions." Curr Genet 13:113-124.2897249
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106