Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsocitrate dehydrogenase [NADP], mitochondrial
Synonyms
  • IDH
  • IDP
  • NADP(+)-specific ICDH
  • Oxalosuccinate decarboxylase
Gene NameIDP1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionMitochondrial IDP1 may regulate flux through the tricarboxylic acid cycle and respiration. Its probably critical function is the production of NADPH
Cellular LocationMitochondrion
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glutathione metabolismec00480 Map00480
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
NADP + Isocitric acidCarbon dioxide + hydron + NADPH + Oxoglutaric acid
KEGG Reactions
NADP + Isocitric acidOxoglutaric acid + Carbon dioxide + NADPH
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00153Oxoglutaric acidShow
YMDB00210Oxalosuccinic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
cation binding
NAD or NADH binding
metal ion binding
isocitrate dehydrogenase (NADP+) activity
oxidoreductase activity
catalytic activity
magnesium ion binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
binding
nucleotide binding
ion binding
isocitrate dehydrogenase activity
Process
isocitrate metabolic process
oxidation reduction
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL066W
Gene Sequence>1287 bp ATGAGTATGTTATCTAGAAGATTATTTTCCACCTCTCGCCTTGCTGCTTTCAGTAAGATT AAGGTCAAACAACCCGTTGTCGAGTTGGACGGTGATGAAATGACCCGTATCATTTGGGAT AAGATCAAGAAGAAATTGATTCTACCCTACTTGGACGTAGATTTGAAGTACTACGACTTA TCTGTCGAATCTCGTGACGCCACCTCCGACAAGATTACTCAGGATGCTGCTGAGGCGATC AAGAAGTATGGTGTTGGTATCAAATGTGCCACCATCACTCCTGATGAAGCTCGTGTGAAG GAATTCAACCTGCACAAGATGTGGAAATCTCCTAATGGTACCATCAGAAACATTCTCGGC GGTACAGTGTTTAGAGAGCCCATTGTGATTCCTAGAATTCCTAGACTGGTCCCACGTTGG GAAAAACCAATCATTATTGGAAGACACGCCCACGGTGATCAATATAAAGCTACGGACACA CTGATCCCAGGCCCAGGATCTTTGGAACTGGTCTACAAGCCATCCGACCCTACGACTGCT CAACCACAAACTTTGAAAGTGTATGACTACAAGGGCAGTGGTGTGGCCATGGCCATGTAC AATACTGACGAATCCATCGAAGGGTTTGCTCATTCGTCTTTCAAGCTGGCCATTGACAAA AAGCTAAATCTTTTCTTGTCAACCAAGAACACTATTTTGAAGAAATATGACGGTCGGTTC AAAGACATTTTCCAAGAAGTTTATGAAGCTCAATATAAATCCAAATTCGAACAACTAGGG ATCCACTATGAACACCGTTTAATTGATGATATGGTCGCTCAAATGATAAAATCTAAAGGT GGCTTTATCATGGCGCTAAAGAACTATGACGGTGATGTCCAATCTGACATCGTCGCTCAA GGATTTGGCTCCTTAGGTTTGATGACTTCTATCTTAGTTACACCAGACGGTAAAACTTTC GAAAGTGAAGCTGCTCATGGTACCGTGACAAGACATTATAGAAAGTACCAAAAGGGTGAA GAAACTTCTACAAACTCCATTGCATCCATTTTCGCGTGGTCGAGAGGTCTATTGAAGAGA GGTGAATTGGACAATACTCCTGCTTTGTGTAAATTTGCCAATATTTTGGAATCCGCCACT TTGAACACAGTTCAGCAAGACGGTATCATGACGAAGGACTTGGCTTTGGCTTGCGGTAAC AACGAAAGATCTGCTTATGTTACCACAGAAGAATTTTTGGATGCCGTTGAAAAAAGACTA CAAAAAGAAATCAAGTCGATCGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues428
Protein Molecular Weight48189.89844
Protein Theoretical pI9.17
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isocitrate dehydrogenase [NADP], mitochondrial MSMLSRRLFSTSRLAAFSKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDL SVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEARVKEFNLHKMWKSPNGTIRNILG GTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSDPTTA QPQTLKVYDYKGSGVAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRF KDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQ GFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKYQKGEETSTNSIASIFAWSRGLLKR GELDNTPALCKFANILESATLNTVQQDGIMTKDLALACGNNERSAYVTTEEFLDAVEKRL QKEIKSIE
References
External Links
ResourceLink
Saccharomyces Genome Database IDP1
Uniprot IDP21954
Uniprot NameIDHP_YEAST
GenBank Gene IDM57229
Genebank Protein ID171749
General Reference
  • Haselbeck, R. J., McAlister-Henn, L. (1991). "Isolation, nucleotide sequence, and disruption of the Saccharomyces cerevisiae gene encoding mitochondrial NADP(H)-specific isocitrate dehydrogenase." J Biol Chem 266:2339-2345.1989987
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867