You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name2-oxoglutarate dehydrogenase, mitochondrial
Synonyms
  • 2-oxoglutarate dehydrogenase complex component E1
  • OGDC-E1
  • Alpha-ketoglutarate dehydrogenase
Gene NameKGD1
Enzyme Class
Biological Properties
General FunctionInvolved in oxoglutarate dehydrogenase (succinyl-transferring) activity
Specific FunctionThe 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components:2- oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3)
Cellular LocationMitochondrion matrix. Mitochondrion matrix, mitochondrion nucleoid
SMPDB Pathways
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Lysine degradationec00310 Map00310
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
Oxoglutaric acid + NAD + Coenzyme ASuccinyl-CoA + NADH + hydron + Carbon dioxide
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00514Succinyl-CoAShow
YMDB00697lipoamideShow
YMDB00747S(8)-succinyldihydrolipoamideShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
oxoglutarate dehydrogenase (succinyl-transferring) activity
catalytic activity
binding
oxidoreductase activity
vitamin binding
thiamin pyrophosphate binding
oxidoreductase activity, acting on the aldehyde or oxo group of donors
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
Gene Properties
Chromosome Locationchromosome 9
LocusYIL125W
Gene Sequence>3045 bp ATGCTAAGGTTCGTGTCTTCGCAAACCTGCCGGTATAGTTCAAGAGGACTATTAAAAACA TCTTTACTTAAAAATGCATCTACTGTCAAAATTGTCGGAAGAGGGTTAGCCACCACTGGT ACAGATAATTTTCTATCGACATCAAATGCCACCTATATCGATGAAATGTACCAAGCTTGG CAAAAAGACCCATCTTCAGTCCATGTTTCATGGGACGCATATTTCAAGAATATGTCTAAC CCAAAGATTCCAGCTACAAAGGCTTTTCAGGCTCCTCCCAGTATCAGTAACTTTCCCCAG GGTACCGAAGCAGCTCCCTTAGGGACCGCAATGACTGGTTCAGTAGATGAGAACGTCTCC ATTCATCTAAAAGTGCAATTGCTATGTAGAGCTTACCAAGTTAGAGGTCATTTAAAAGCC CATATAGATCCTTTAGGGATCTCATTTGGTAGTAATAAAAATAACCCTGTTCCTCCGGAA TTGACTCTAGACTACTACGGCTTTAGCAAACACGATCTTGATAAAGAAATCAACCTAGGA CCTGGTATCCTGCCAAGGTTTGCAAGGGACGGGAAATCTAAAATGTCTCTGAAAGAGATT GTGGATCATCTAGAAAAGTTATATTGTTCCTCTTATGGGGTACAATACACACATATTCCA TCTAAGCAAAAGTGTGATTGGTTAAGAGAGAGAATTGAGATTCCTGAACCTTACCAATAT ACAGTGGACCAAAAGAGACAAATCTTAGATAGATTAACATGGGCCACTTCTTTTGAGTCA TTCTTATCTACAAAATTTCCAAATGATAAGAGGTTCGGTTTAGAAGGTTTGGAAAGTGTT GTTCCAGGTATTAAAACTTTGGTTGATCGTTCTGTTGAATTGGGTGTAGAAGATATTGTT TTGGGTATGGCTCACCGTGGTAGATTGAACGTTTTATCCAATGTGGTCCGTAAACCAAAT GAATCTATTTTTCTGAATTTAAAGGGTTCGAGCGCTCGCGATGATATTGAAGGATCGGGT GATGTCAAGTACCATTTGGGTATGAACTACCAAAGACCAACTACGTCTGGTAAGTACGTC AATTTATCGCTGGTGGCAAATCCTTCTCATTTAGAATCCCAAGATCCAGTTGTTCTTGGT AGAACTAGAGCTTTATTGCATGCCAAGAACGATTTGAAGGAAAAAACAAAGGCCTTAGGT GTGTTATTACATGGTGATGCTGCTTTTGCTGGGCAGGGTGTTGTTTATGAAACCATGGGT TTCTTGACCCTACCAGAATACTCTACTGGTGGTACTATTCATGTTATTACAAACAACCAG ATCGGATTCACTACGGATCCAAGATTTGCAAGGTCCACACCATATCCTTCCGATTTGGCT AAGGCCATTGATGCCCCAATTTTCCATGTTAACGCTAATGACGTGGAAGCTGTGACCTTT ATTTTCAATTTAGCCGCAGAATGGAGACATAAGTTCCACACAGATGCCATAATTGATGTC GTTGGTTGGAGAAAACATGGACATAATGAAACCGATCGACCATCGTTTACTCAACCATTA ATGTACAAAAAAATTGCAAAACAAAAATCTGTCATTGACGTCTATACGGAAAAATTGATA AGTGAAGGCACATTTTCTAAAAAAGATATTGATGAGCACAAGAAATGGGTATGGAACTTA TTTGAAGATGCTTTCGAAAAGACAAAGGATTACGTCCCATCTCAAAGAGAATGGTTAACT GCTGCCTGGGAAGGATTCAAATCCCCAAAGGAATTGGCCACTGAGATATTACCACATGAA CCAACTAATGTTCCAGAGAGTACTTTGAAAGAACTAGGTAAGGTACTCTCTTCGTGGCCA GAAGGTTTTGAAGTGCACAAAAATCTAAAGAGAATTTTGAAAAATAGAGGAAAATCTATT GAGACAGGTGAAGGCATCGATTGGGCCACCGGTGAAGCATTAGCGTTCGGTACATTGGTT TTGGATGGTCAGAACGTTAGGGTTTCCGGTGAAGATGTAGAAAGAGGTACATTTTCTCAA CGTCATGCAGTCTTGCATGACCAACAATCTGAAGCCATTTACACACCGCTAAGCACTCTG AATAATGAAAAGGCAGACTTCACCATTGCAAATTCCTCGTTATCTGAGTACGGTGTAATG GGTTTCGAATATGGTTATTCGCTAACCTCCCCAGATTATCTAGTCATGTGGGAGGCTCAA TTCGGTGACTTTGCAAATACAGCACAGGTTATTATTGACCAATTTATTGCCGGTGGTGAA CAAAAATGGAAGCAACGCTCTGGTTTAGTTTTGTCTTTACCCCATGGTTATGATGGCCAG GGGCCAGAACATTCGTCTGGTAGATTGGAAAGATTCTTGCAACTAGCCAATGAAGACCCA AGATATTTCCCATCTGAAGAAAAGCTACAGAGACAACATCAGGATTGTAATTTCCAGGTT GTTTATCCAACTACGCCTGCTAATTTATTCCACATTCTAAGGAGACAGCAACATCGTCAA TTCCGTAAACCATTGGCGTTATTCTTTTCTAAACAGCTGCTGCGTCACCCATTGGCCAGA TCATCTCTTTCCGAATTCACTGAAGGCGGATTCCAATGGATTATCGAAGATATTGAACAT GGAAAAAGTATTGGTACGAAAGAGGAAACCAAGAGATTAGTTTTGCTGAGTGGCCAAGTG TACACTGCCCTACATAAAAGACGTGAAAGTTTGGGTGATAAGACCACTGCTTTCTTAAAG ATTGAACAGCTGCACCCATTCCCATTTGCTCAGCTACGTGATTCATTAAATTCTTATCCA AACTTGGAAGAAATTGTTTGGTGCCAGGAAGAGCCATTGAACATGGGTTCGTGGGCATAC ACAGAACCACGCTTACACACAACATTAAAAGAAACGGATAAATATAAGGATTTCAAGGTC AGATACTGTGGTAGAAACCCAAGTGGTGCTGTTGCTGCCGGTAGCAAATCACTACATTTG GCCGAAGAAGATGCCTTTTTGAAAGATGTTTTCCAACAATCCTAA
Protein Properties
Pfam Domain Function
Protein Residues1014
Protein Molecular Weight114416.0
Protein Theoretical pI7.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>2-oxoglutarate dehydrogenase, mitochondrial MLRFVSSQTCRYSSRGLLKTSLLKNASTVKIVGRGLATTGTDNFLSTSNATYIDEMYQAW QKDPSSVHVSWDAYFKNMSNPKIPATKAFQAPPSISNFPQGTEAAPLGTAMTGSVDENVS IHLKVQLLCRAYQVRGHLKAHIDPLGISFGSNKNNPVPPELTLDYYGFSKHDLDKEINLG PGILPRFARDGKSKMSLKEIVDHLEKLYCSSYGVQYTHIPSKQKCDWLRERIEIPEPYQY TVDQKRQILDRLTWATSFESFLSTKFPNDKRFGLEGLESVVPGIKTLVDRSVELGVEDIV LGMAHRGRLNVLSNVVRKPNESIFSEFKGSSARDDIEGSGDVKYHLGMNYQRPTTSGKYV NLSLVANPSHLESQDPVVLGRTRALLHAKNDLKEKTKALGVLLHGDAAFAGQGVVYETMG FLTLPEYSTGGTIHVITNNQIGFTTDPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTF IFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYKKIAKQKSVIDVYTEKLI SEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPSQREWLTAAWEGFKSPKELATEILPHE PTNVPESTLKELGKVLSSWPEGFEVHKNLKRILKNRGKSIETGEGIDWATGEALAFGTLV LDGQNVRVSGEDVERGTFSQRHAVLHDQQSEAIYTPLSTLNNEKADFTIANSSLSEYGVM GFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQ GPEHSSGRLERFLQLANEDPRYFPSEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQ FRKPLALFFSKQLLRHPLARSSLSEFTEGGFQWIIEDIEHGKSIGTKEETKRLVLLSGQV YTALHKRRESLGDKTTAFLKIEQLHPFPFAQLRDSLNSYPNLEEIVWCQEEPLNMGSWAY TEPRLHTTLKETDKYKDFKVRYCGRNPSGAVAAGSKSLHLAEEDAFLKDVFQQS
References
External Links
ResourceLink
Saccharomyces Genome Database KGD1
Uniprot IDP20967
Uniprot NameODO1_YEAST
GenBank Gene IDM26390
Genebank Protein ID171785
General Reference
  • Repetto, B., Tzagoloff, A. (1989). "Structure and regulation of KGD1, the structural gene for yeast alpha-ketoglutarate dehydrogenase." Mol Cell Biol 9:2695-2705.2503710
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Mockovciakova, D., Janitorova, V., Zigova, M., Kaclikova, E., Zagulski, M., Subik, J. (1993). "The ogd1 and kgd1 mutants lacking 2-oxoglutarate dehydrogenase activity in yeast are allelic and can be differentiated by the cloned amber suppressor." Curr Genet 24:377-381.8299151
  • Sato, H., Tachifuji, A., Tamura, M., Miyakawa, I. (2002). "Identification of the YMN-1 antigen protein and biochemical analyses of protein components in the mitochondrial nucleoid fraction of the yeast Saccharomyces cerevisiae." Protoplasma 219:51-58.11926067
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956