You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhospho-2-dehydro-3-deoxyheptonate aldolase, phenylalanine-inhibited
Synonyms
  • 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
  • DAHP synthase
  • Phospho-2-keto-3-deoxyheptonate aldolase
Gene NameARO3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionStereospecific condensation of phosphoenolpyruvate (PEP) and D-erythrose-4-phosphate (E4P) giving rise to 3-deoxy-D- arabino-heptulosonate-7-phosphate (DAHP)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB ReactionsNot Available
KEGG Reactions
D-Erythrose 4-phosphate + Phosphoenolpyruvic acid + waterphosphate + 7-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acid
Metabolites
YMDB IDNameView
YMDB000317-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acidShow
YMDB00223D-Erythrose 4-phosphateShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
3-deoxy-7-phosphoheptulonate synthase activity
Process
metabolic process
biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
aromatic amino acid family biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR035W
Gene Sequence>1113 bp ATGTTCATTAAAAACGATCACGCCGGTGACAGGAAACGCTTGGAAGACTGGAGAATCAAA GGTTATGATCCATTAACCCCTCCAGATCTGCTTCAACATGAATTTCCAATTTCAGCCAAA GGTGAGGAAAACATTATCAAGGCAAGAGACTCCGTCTGTGATATTTTGAATGGTAAAGAT GATCGTTTAGTTATCGTGATCGGGCCATGTTCCCTACATGACCCCAAAGCCGCTTACGAT TACGCTGACAGATTGGCTAAAATTTCAGAAAAGTTGTCAAAAGACTTATTGATTATTATG AGAGCGTATTTAGAAAAACCAAGGACTACTGTTGGCTGGAAAGGGTTGATTAACGACCCT GATATGAATAACTCTTTTCAAATCAATAAAGGTCTACGGATTTCGAGAGAAATGTTCATA AAACTGGTTGAAAAATTACCCATTGCTGGTGAGATGTTGGATACCATTTCTCCGCAGTTT TTGAGTGATTGTTTCTCCTTGGGTGCCATCGGCGCCAGAACTACTGAATCCCAACTGCAC AGAGAATTAGCATCCGGTCTATCTTTCCCTATTGGATTTAAGAACGGTACTGATGGTGGT TTGCAAGTCGCCATCGACGCTATGAGAGCCGCTGCACATGAACATTACTTCCTTTCTGTC ACAAAGCCAGGTGTCACTGCTATCGTGGGCACTGAAGGTAACAAGGATACCTTCCTGATC TTGAGAGGTGGTAAGAACGGTACTAACTTTGACAAAGAAAGTGTTCAAAATACTAAGAAA CAGTTAGAAAAGGCCGGTTTGACTGATGATTCCCAGAAAAGAATTATGATCGATTGTTCC CACGGCAACAGTAATAAAGATTTCAAGAACCAACCAAAGGTTGCCAAATGTATTTATGAC CAGCTGACGGAGGGTGAGAATAGTCTCTGTGGTGTTATGATTGAGTCCAACATAAATGAA GGTAGACAAGATATTCCCAAAGAAGGTGGCAGAGAGGGATTGAAGTATGGTTGTTCTGTT ACGGATGCTTGTATTGGCTGGGAGTCCACCGAACAGGTATTGGAGCTATTGGCAGAAGGT GTTAGAAACAGAAGAAAGGCCTTGAAAAAATAG
Protein Properties
Pfam Domain Function
Protein Residues370
Protein Molecular Weight41069.5
Protein Theoretical pI7.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phospho-2-dehydro-3-deoxyheptonate aldolase, phenylalanine-inhibited MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI LRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQKRIMIDCSHGNSNKDFKNQPKVAKCIYD QLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLAEG VRNRRKALKK
References
External Links
ResourceLink
Saccharomyces Genome Database ARO3
Uniprot IDP14843
Uniprot NameAROF_YEAST
GenBank Gene IDAY557657
Genebank Protein ID45269207
General Reference
  • Paravicini, G., Braus, G., Hutter, R. (1988). "Structure of the ARO3 gene of Saccharomyces cerevisiae." Mol Gen Genet 214:165-169.2906401
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956