You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucosamine--fructose-6-phosphate aminotransferase [isomerizing]
Synonyms
  • GFAT
  • D-fructose-6-phosphate amidotransferase
  • Hexosephosphate aminotransferase
Gene NameGFA1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionInvolved in amino sugar synthesis (formation of chitin, supplies the amino sugars of asparagine-linked oligosaccharides of glycoproteins)
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
Beta-D-Fructose 6-phosphate + L-GlutamineGlucosamine 6-phosphate + L-Glutamic acid
KEGG Reactions
Fructose 6-phosphate + L-GlutamineL-Glutamic acid + Glucosamine 6-phosphate
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00044Glucosamine 6-phosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00271L-Glutamic acidShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
cytoplasm
intracellular part
cell part
Function
binding
carbohydrate binding
sugar binding
transferase activity, transferring nitrogenous groups
transaminase activity
glutamine-fructose-6-phosphate transaminase (isomerizing) activity
catalytic activity
transferase activity
Process
primary metabolic process
carbohydrate metabolic process
carbohydrate biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL104C
Gene Sequence>2154 bp ATGTGTGGTATCTTTGGTTACTGCAATTATCTAGTGGAAAGATCCAGAGGAGAAATTATC GACACCTTAGTGGATGGTTTACAAAGATTAGAATATAGAGGCTATGATTCCACCGGTATT GCTATCGATGGTGACGAAGCTGATTCTACTTTCATCTATAAGCAAATCGGTAAAGTGAGT GCTTTGAAAGAGGAGATTACTAAGCAAAATCCGAACAGAGACGTTACTTTTGTCTCTCAT TGTGGTATTGCGCATACTAGATGGGCTACTCACGGTCGACCAGAACAAGTTAACTGTCAC CCTCAAAGATCTGACCCAGAAGACCAATTTGTGGTCGTTCATAATGGTATCATCACAAAT TTTAGAGAACTGAAGACTCTTTTAATTAACAAAGGTTATAAATTCGAAAGTGATACCGAT ACCGAGTGTATTGCTAAACTATATTTGCATTTATACAATACAAATTTACAAAATGGGCAT GACTTAGATTTCCACGAATTAACCAAGCTAGTTCTTTTAGAACTAGAAGGTTCATACGGG TTATTATGTAAATCTTGTCACTATCCTAATGAGGTTATCGCCACTAGAAAAGGGTCCCCT TTACTGATTGGTGTCAAATCTGAAAAAAAACTAAAAGTCGACTTCGTGGATGTGGAATTT CCCGAAGAAAACGCTGGTCAACCGGAAATTCCATTGAAATCTAACAACAAATCATTTGGC TTGGGCCCAAAGAAAGCTCGTGAATTTGAAGCTGGTTCCCAAAATGCCAATTTACTACCA ATTGCCGCCAATGAATTTAACTTGAGACATTCTCAATCCAGGGCTTTCCTATCAGAAGAT GGATCTCCAACACCGGTGGAATTTTTTGTTTCTTCGGATGCGGCATCTGTTGTTAAACAT ACCAAGAAGGTGCTATTTTTAGAAGATGACGATTTGGCTCATATTTACGATGGTGAGTTA CATATTCATAGATCTAGAAGAGAAGTAGGCGCATCAATGACAAGGTCCATTCAAACTTTA GAGATGGAGTTAGCTCAGATCATGAAGGGCCCTTACGACCATTTTATGCAAAAGGAAATC TATGAGCAACCAGAATCTACTTTCAATACTATGAGAGGTAGAATCGACTATGAAAATAAT AAAGTGATATTGGGTGGTTTAAAGGCATGGTTACCAGTTGTCAGAAGAGCACGGAGACTG ATCATGATCGCATGCGGTACTTCTTATCATTCATGTTTGGCTACTCGTGCTATCTTCGAA GAATTATCAGATATCCCAGTTAGTGTGGAATTAGCGTCTGACTTTCTGGACAGAAAATGC CCTGTCTTCAGAGACGATGTATGCGTGTTTGTTTCACAAAGTGGTGAAACTGCGGATACC ATGCTGGCTCTAAATTATTGTTTAGAAAGAGGAGCCTTAACTGTCGGAATTGTTAACAGT GTTGGTTCTTCTATCTCTCGTGTCACCCACTGTGGTGTTCATATTAACGCTGGTCCTGAA ATTGGTGTTGCCTCTACAAAAGCTTATACTTCCCAGTATATTGCCTTAGTGATGTTTGCT CTATCGCTGTCAGATGACCGTGTATCGAAAATAGACAGAAGAATTGAAATCATTCAAGGC TTGAAGTTAATCCCGGGCCAAATTAAGCAGGTATTAAAGCTGGAACCAAGAATAAAAAAG CTCTGTGCGACTGAATTAAAGGATCAAAAATCTCTATTGTTATTGGGTAGAGGTTACCAA TTTGCTGCTGCTCTGGAAGGTGCTTTGAAGATCAAAGAAATTTCTTATATGCATTCTGAA GGTGTTTTGGCAGGTGAGTTGAAGCACGGTGTCTTGGCCTTGGTGGACGAAAACTTGCCA ATCATTGCTTTTGGTACCAGAGACTCTCTATTCCCTAAAGTAGTTTCCTCTATTGAGCAA GTTACTGCAAGAAAGGGCCATCCAATTATTATTTGTAACGAAAATGATGAAGTGTGGGCG CAAAAATCTAAATCAATCGACCTGCAAACCTTAGAAGTTCCACAAACTGTTGATTGTTTA CAAGGTCTAATTAATATTATTCCATTACAACTAATGTCATATTGGTTGGCTGTTAATAAA GGGATTGATGTTGATTTTCCAAGAAACTTGGCTAAATCTGTTACCGTCGAATAA
Protein Properties
Pfam Domain Function
Protein Residues717
Protein Molecular Weight80046.0
Protein Theoretical pI6.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] MCGIFGYCNYLVERSRGEIIDTLVDGLQRLEYRGYDSTGIAIDGDEADSTFIYKQIGKVS ALKEEITKQNPNRDVTFVSHCGIAHTRWATHGRPEQVNCHPQRSDPEDQFVVVHNGIITN FRELKTLLINKGYKFESDTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEGSYG LLCKSCHYPNEVIATRKGSPLLIGVKSEKKLKVDFVDVEFPEENAGQPEIPLKSNNKSFG LGPKKAREFEAGSQNANLLPIAANEFNLRHSQSRAFLSEDGSPTPVEFFVSSDAASVVKH TKKVLFLEDDDLAHIYDGELHIHRSRREVGASMTRSIQTLEMELAQIMKGPYDHFMQKEI YEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGTSYHSCLATRAIFE ELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYCLERGALTVGIVNS VGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKIDRRIEIIQG LKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEGALKIKEISYMHSE GVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNENDEVWA QKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFPRNLAKSVTVE
References
External Links
ResourceLink
Saccharomyces Genome Database GFA1
Uniprot IDP14742
Uniprot NameGFA1_YEAST
GenBank Gene IDX71133
Genebank Protein ID431212
General Reference
  • Watzele, G., Tanner, W. (1989). "Cloning of the glutamine:fructose-6-phosphate amidotransferase gene from yeast. Pheromonal regulation of its transcription." J Biol Chem 264:8753-8758.2656689
  • Cheret, G., Pallier, C., Valens, M., Diagnan-Fornier, B., Fukuhara, H., Bolotin-Fukuhara, M., Sor, F. (1993). "The DNA sequence analysis of the HAP4-LAP4 region on chromosome XI of Saccharomyces cerevisiae suggests the presence of a second aspartate aminotransferase gene in yeast." Yeast 9:1259-1265.8109175
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956