You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCholine-phosphate cytidylyltransferase
Synonyms
  • CTP:phosphocholine cytidylyltransferase
  • CCT
  • CT
  • Phosphorylcholine transferase
Gene NamePCT1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCTP + choline phosphate = diphosphate + CDP- choline
Cellular LocationMembrane.
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Phosphorylcholine + Cytidine triphosphate + hydronCiticoline + Pyrophosphate
KEGG Reactions
Phosphorylcholine + hydron + Cytidine triphosphatePyrophosphate + Citicoline
Metabolites
YMDB IDNameView
YMDB00090CiticolineShow
YMDB00191PhosphorylcholineShow
YMDB00219PyrophosphateShow
YMDB00279Cytidine triphosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
catalytic activity
transferase activity
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR202C
Gene Sequence>1275 bp ATGGCAAACCCAACAACAGGGAAGTCCTCGATTAGGGCTAAGCTTTCTAACTCATCGCTA TCAAACCTATTTAAAAAAAATAAAAATAAAAGACAGCGTGAGGAAACGGAAGAGCAGGAC AATGAGGATAAGGATGAGAGTAAGAACCAGGATGAAAATAAGGACACACAGCTCACTCCC CGCAAGCGTCGCCGGTTGACGAAGGAGTTTGAAGAGAAGGAGGCTCGTTACACCAACGAG TTGCCCAAGGAACTGCGCAAGTATCGTCCTAAAGGTTTCAGATTCAATTTGCCTCCAACG GATAGACCCATCAGGATATATGCAGATGGTGTTTTTGATCTTTTCCATCTTGGCCACATG AAGCAACTGGAACAGTGTAAGAAGGCTTTCCCCAATGTAACACTGATAGTTGGTGTGCCT AGCGACAAAATCACTCACAAACTAAAAGGTTTGACTGTGCTGACCGATAAGCAGCGTTGT GAAACTTTAACGCACTGCAGATGGGTTGACGAAGTCGTGCCCAACGCTCCCTGGTGTGTC ACCCCAGAATTTCTACTAGAACACAAGATTGACTACGTGGCACATGACGATATTCCTTAC GTTAGCGCCGACAGCGACGATATCTACAAGCCAATAAAGGAGATGGGAAAATTCTTGACT ACCCAAAGAACCAATGGTGTCTCTACAAGTGATATTATCACAAAGATCATCAGAGATTAT GACAAATATTTGATGAGAAACTTTGCAAGGGGTGCTACCAGACAGGAGCTGAACGTTTCT TGGTTGAAGAAAAACGAACTGGAGTTCAAAAAACACATCAATGAATTCAGGTCATATTTC AAGAAAAACCAGACAAATTTGAATAACGCCTCCAGAGACTTGTACTTCGAAGTCCGTGAA ATCTTGCTAAAGAAAACGTTGGGCAAAAAACTCTACTCCAAGTTAATAGGCAATGAATTA AAGAAACAAAATCAACGACAAAGAAAACAGAATTTTTTGGATGATCCGTTTACTAGGAAG CTAATCAGGGAGGCCTCTCCGGCTACAGAGTTTGCCAACGAATTTACGGGCGAAAACTCT ACCGCTAAATCACCGGATGACAATGGAAATCTTTTCAGTCAGGAAGATGATGAAGACACA AATTCTAACAACACGAATACAAATTCAGATTCAGATTCAAACACTAACTCAACGCCTCCC AGTGAAGATGACGACGACAACGACAGGTTAACTTTGGAAAACCTAACACAGAAGAAGAAA CAATCAGCGAACTGA
Protein Properties
Pfam Domain Function
Protein Residues424
Protein Molecular Weight49405.80078
Protein Theoretical pI9.12
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Choline-phosphate cytidylyltransferase MANPTTGKSSIRAKLSNSSLSNLFKKNKNKRQREETEEQDNEDKDESKNQDENKDTQLTP RKRRRLTKEFEEKEARYTNELPKELRKYRPKGFRFNLPPTDRPIRIYADGVFDLFHLGHM KQLEQCKKAFPNVTLIVGVPSDKITHKLKGLTVLTDKQRCETLTHCRWVDEVVPNAPWCV TPEFLLEHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTNGVSTSDIITKIIRDY DKYLMRNFARGATRQELNVSWLKKNELEFKKHINEFRSYFKKNQTNLNNASRDLYFEVRE ILLKKTLGKKLYSKLIGNELKKQNQRQRKQNFLDDPFTRKLIREASPATEFANEFTGENS TAKSPDDNGNLFSQEDDEDTNSNNTNTNSDSDSNTNSTPPSEDDDDNDRLTLENLTQKKK QSAN
References
External Links
ResourceLink
Saccharomyces Genome Database PCT1
Uniprot IDP13259
Uniprot NamePCY1_YEAST
GenBank Gene IDAY557840
Genebank Protein ID45269571
General Reference
  • Tsukagoshi, Y., Nikawa, J., Yamashita, S. (1987). "Molecular cloning and characterization of the gene encoding cholinephosphate cytidylyltransferase in Saccharomyces cerevisiae." Eur J Biochem 169:477-486.2826147
  • Guerreiro, P., Barreiros, T., Soares, H., Cyrne, L., Maia e Silva, A., Rodrigues-Pousada, C. (1996). "Sequencing of a 17.6 kb segment on the right arm of yeast chromosome VII reveals 12 ORFs, including CCT, ADE3 and TR-I genes, homologues of the yeast PMT and EF1G genes, of the human and bacterial electron-transferring flavoproteins (beta-chain) and of the Escherichia coli phosphoserine phosphohydrolase, and five new ORFs." Yeast 12:273-280.8904340
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956