You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutaminyl-tRNA synthetase
Synonyms
  • Glutamine--tRNA ligase
  • GlnRS
Gene NameGLN4
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-glutamine + tRNA(Gln) = AMP + diphosphate + L-glutaminyl-tRNA(Gln)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Glutamine + tRNA(Gln) → Adenosine monophosphate + Pyrophosphate + Gln-tRNA(Gln)
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
nucleotide binding
ligase activity
binding
glutamine-tRNA ligase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
Process
macromolecule metabolic process
glutaminyl-tRNA aminoacylation
cellular macromolecule metabolic process
biosynthetic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR168W
Gene Sequence>2430 bp ATGTCTTCTGTAGAAGAATTGACTCAGCTGTTTTCACAGGTTGGGTTTGAAGATAAAAAG GTGAAGGAGATTGTCAAGAATAAAAAGGTTTCTGATTCACTTTACAAATTGATTAAGGAG ACTCCTTCGGACTATCAATGGAACAAATCTACTAGAGCGCTAGTACACAACCTGGCATCT TTTGTCAAAGGTACAGATCTACCCAAGTCTGAATTAATTGTTAACGGCATCATTAATGGT GATTTGAAGACATCTCTGCAAGTCGATGCCGCATTTAAATATGTAAAGGCTAATGGCGAG GCATCCACCAAAATGGGTATGAATGAAAACTCTGGTGTTGGTATTGAGATTACAGAGGAT CAGGTTAGAAATTACGTCATGCAGTACATTCAAGAAAACAAGGAAAGAATTTTAACTGAA CGCTATAAACTGGTGCCAGGTATTTTTGCCGATGTTAAAAACTTAAAGGAGCTGAAGTGG GCCGATCCACGTAGTTTCAAGCCAATTATCGACCAAGAAGTCTTAAAACTTTTGGGTCCA AAGGATGAGAGAGACTTAATCAAGAAGAAGACCAAGAATAATGAAAAGAAGAAAACCAAT TCTGCCAAGAAGAGTTCTGATAATTCTGCATCATCCGGTCCAAAGAGGACTATGTTCAAT GAAGGTTTCCTAGGTGATTTGCATAAAGTGGGTGAAAACCCACAAGCTTACCCAGAATTA ATGAAGGAACACCTTGAGGTTACTGGTGGCAAAGTTCGTACAAGGTTCCCTCCGGAGCCC AATGGATATTTGCATATTGGTCATTCTAAAGCTATTATGGTTAATTTTGGCTATGCTAAA TATCACAATGGTACCTGTTATTTAAGATTTGACGATACCAACCCCGAAAAGGAAGCTCCT GAATATTTTGAATCCATTAAGAGAATGGTTTCTTGGTTAGGTTTTAAACCATGGAAAATT ACTTACTCAAGTGATTATTTTGACGAGCTTTATCGCCTCGCTGAAGTGTTGATCAAAAAC GGCAAAGCTTACGTTTGTCATTGTACCGCCGAAGAAATTAAAAGAGGTCGTGGTATTAAA GAAGACGGTACTCCAGGTGGGGAGAGATATGCTTGTAAGCATCGTGATCAGTCGATAGAA CAAAACCTGCAAGAATTCAGAGATATGAGAGATGGCAAGTACAAACCTGGTGAAGCTATC TTAAGAATGAAACAGGATCTAAATTCACCAAGCCCACAAATGTGGGACTTGATTGCGTAT AGAGTTTTAAATGCTCCACATCCAAGAACGGGAACAAAATGGAGAATTTATCCTACTTAC GATTTTACACATTGTTTGGTCGATTCAATGGAAAATATTACACATTCTTTATGTACTACT GAATTCTACCTATCTAGAGAAAGCTATGAATGGTTATGTGATCAGGTTCATGTGTTCAGA CCCGCTCAAAGAGAATATGGTCGTTTGAATATCACCGGTACAGTTTTATCCAAAAGAAAA ATTGCGCAATTGGTGGATGAAAAATTCGTTAGAGGCTGGGACGATCCTAGACTATTCACG CTTGAAGCTATACGCAGACGTGGTGTTCCTCCTGGTGCCATTTTATCCTTTATCAACACA TTAGGTGTTACCACAAGTACCACAAACATTCAAGTTGTGAGGTTTGAGAGCGCTGTTAGA AAGTACCTAGAAGATACCACACCGAGATTAATGTTTGTGTTGGATCCTGTTGAAGTTGTT GTCGATAATTTATCTGACGATTATGAAGAATTGGCAACTATTCCTTACAGACCTGGTACT CCAGAATTTGGTGAAAGAACTGTACCATTTACAAACAAATTCTACATTGAAAGGTCAGAT TTCTCAGAAAACGTTGATGATAAGGAATTTTTCAGATTAACACCAAACCAACCAGTTGGT TTAATTAAAGTCTCACACACAGTTTCTTTCAAAAGTTTGGAAAAAGATGAAGCTGGTAAA ATTATAAGAATTCATGTCAACTATGATAACAAGGTTGAAGAAGGTTCGAAACCAAAGAAA CCAAAAACTTATATTCAATGGGTTCCTATCTCTTCAAAATATAATTCTCCATTGAGAGTT ACTGAAACTAGGGTTTACAACCAATTGTTCAAATCTGAAAATCCATCTTCTCATCCTGAA GGCTTCTTGAAGGACATCAACCCAGAAAGTGAAGTCGTTTATAAAGAATCTGTCATGGAA CATAACTTCGGGGACGTTGTCAAGAACAGTCCATGGGTCGTTGATTCTGTTAAAAACTCG GAATTTTATGTTGAAGAAGATAAGGATTCCAAAGAAGTGTGTAGATTCCAAGCTATGAGA GTAGGTTATTTCACTCTGGATAAAGAGAGTACGACTTCTAAGGTTATTTTGAATAGAATA GTTAGCTTGAAGGACGCAACTTCCAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues809
Protein Molecular Weight93132.20313
Protein Theoretical pI8.67
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutaminyl-tRNA synthetase MSSVEELTQLFSQVGFEDKKVKEIVKNKKVSDSLYKLIKETPSDYQWNKSTRALVHNLAS FVKGTDLPKSELIVNGIINGDLKTSLQVDAAFKYVKANGEASTKMGMNENSGVGIEITED QVRNYVMQYIQENKERILTERYKLVPGIFADVKNLKELKWADPRSFKPIIDQEVLKLLGP KDERDLIKKKTKNNEKKKTNSAKKSSDNSASSGPKRTMFNEGFLGDLHKVGENPQAYPEL MKEHLEVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAP EYFESIKRMVSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIK EDGTPGGERYACKHRDQSIEQNLQEFRDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAY RVLNAPHPRTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFR PAQREYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINT LGVTTSTTNIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRPGT PEFGERTVPFTNKFYIERSDFSENVDDKEFFRLTPNQPVGLIKVSHTVSFKSLEKDEAGK IIRIHVNYDNKVEEGSKPKKPKTYIQWVPISSKYNSPLRVTETRVYNQLFKSENPSSHPE GFLKDINPESEVVYKESVMEHNFGDVVKNSPWVVDSVKNSEFYVEEDKDSKEVCRFQAMR VGYFTLDKESTTSKVILNRIVSLKDATSK
References
External Links
ResourceLink
Saccharomyces Genome Database GLN4
Uniprot IDP13188
Uniprot NameSYQ_YEAST
GenBank Gene IDU55021
Genebank Protein ID1293729
General Reference
  • Ludmerer, S. W., Schimmel, P. (1987). "Gene for yeast glutamine tRNA synthetase encodes a large amino-terminal extension and provides a strong confirmation of the signature sequence for a group of the aminoacyl-tRNA synthetases." J Biol Chem 262:10801-10806.3301841
  • Madania, A., Poch, O., Tarassov, I., Winsor, B., Martin, R. (1996). "Analysis of a 22,956 bp region on the right arm of Saccharomyces cerevisiae chromosome XV." Yeast 12:1563-1573.8972579
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356