You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlcohol dehydrogenase 4
Synonyms
  • Alcohol dehydrogenase IV
  • ADHIV
Gene NameADH4
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionReduces acetaldehyde to ethanol during glucose fermentation. Specific for ethanol. Shows drastically reduced activity towards primary alcohols from 4 carbon atoms upward. Isomers of aliphatic alcohol, as well as secondary alcohols and glycerol are not used at all
Cellular LocationMitochondrion
SMPDB Pathways
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid metabolismec00071 Map00071
Glycine, serine and threonine metabolismec00260 Map00260
Glycolysis / Gluconeogenesisec00010 Map00010
Tyrosine metabolismec00350 Map00350
SMPDB ReactionsNot Available
KEGG Reactions
Ethanol + NADNADH + Acetaldehyde + hydron
2-Methylbutanal + NADH + hydronNAD + 2-methylbutan-1-ol
NADH + Phenylacetaldehyde + hydronNAD + 2-phenylethanol
NADH + 3-methylbutanal + hydronNAD + isoamylol
NADH + isobutyraldehyde + hydronNAD + isobutanol
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00110NADShow
YMDB00116PhenylacetaldehydeShow
YMDB00143NADHShow
YMDB00354IndoleacetaldehydeShow
YMDB00412NAD(+)Show
YMDB00482isobutyraldehydeShow
YMDB004852-MethylbutanalShow
YMDB004993-methylbutanalShow
YMDB005672-methylbutan-1-olShow
YMDB00570isoamylolShow
YMDB00573isobutanolShow
YMDB00577tryptopholShow
YMDB00862hydronShow
YMDB00883EthanolShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
ion binding
cation binding
metal ion binding
oxidoreductase activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL256W
Gene Sequence>1149 bp ATGTCTTCCGTTACTGGGTTTTACATTCCACCAATCTCTTTCTTTGGTGAAGGTGCTTTA GAAGAAACCGCTGATTACATCAAAAACAAGGATTACAAAAAGGCTTTGATCGTTACTGAT CCTGGTATTGCAGCTATTGGTCTCTCCGGTAGAGTCCAAAAGATGTTGGAAGAACGTGGC TTAAACGTTGCTATCTATGACAAAACTCAACCAAACCCAAATATTGCCAATGTCACAGCT GGTTTGAAGGTTTTGAAGGAAGAAAACTCTGAAATTGTCGTTTCCATTGGTGGTGGTTCT GCTCACGACAATGCTAAGGCCATTGCTTTATTGGCTACTAACGGTGGGGAAATTGGAGAT TATGAAGGTGTCAACCAATCTAAGAAGGCTGCTTTACCGCTATTTGCCATCAACACTACT GCTGGTACTGCTTCCGAGATGACCAGATTCACTATTATCTCTAATGAAGAAAAGAAAATC AAGATGGCCATCATTGACAACAACGTCACTCCAGCTGTTGCTGTCAACGACCCATCTACC ATGTTTGGTTTGCCACCTGCTTTGACTGCTGCTACTGGTCTAGATGCTTTGACTCACTGT ATCGAAGCTTACGTTTCCACCGCCTCTAACCCAATCACCGATGCTTGTGCTTTGAAGGGT ATTGATTTGATCAATGAAAGCTTGGTCGCCGCATACAAAGACGGTAAAGACAAGAAGGCC AGAACTGATATGTGTTACGCAGAATACTTGGCAGGTATGGCTTTCAACAATGCTTCTCTA GGTTATGTTCATGCCCTTGCTCATCAACTTGGTGGTTTCTACCACTTGCCTCATGGTGTT TGTAACGCTGTCTTGTTGCCTCATGTTCAAGAGGCCAACATGCAATGTCCAAAGGCCAAG AAGAGATTAGGTGAAATTGCCTTGCATTGCGGTGCTTCTCAAGAAGATCCAGAAGAAACC ATCAAGGCTTTGCACGTTTTAAACAGAACCATGAACATTCCAAGAAACTTGAAAGACTTA GGTGTTAAAACCGAAGATTTTGACATTTTGGCTGAACACGCCATGCATGATGCCTGCCAT TTGACTAACCCAGTTCAATTCACCAAAGAACAAGTGGTTGCCATTATCAAGAAAGCCTAT GAATATTAA
Protein Properties
Pfam Domain Function
Protein Residues382
Protein Molecular Weight41141.69922
Protein Theoretical pI6.09
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alcohol dehydrogenase 4 MSSVTGFYIPPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERD LNVAIYDKTQPNPNIANVTAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGEIGD YEGVNQSKKAALPLFAINTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPST MFGLPPALTAATGLDALTHCIEAYVSTASNPITDACALKGIDLINESLVAAYKDGKDKKA RTDMCYAEYLAGMAFNNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCPKAK KRLGEIALHFGASQEDPEETIKALHVLNRTMNIPRNLKELGVKTEDFEILAEHAMHDACH LTNPVQFTKEQVVAIIKKAYEY
References
External Links
ResourceLink
Saccharomyces Genome Database ADH4
Uniprot IDP10127
Uniprot NameADH4_YEAST
GenBank Gene IDX05992
Genebank Protein ID3337
General Reference
  • Williamson, V. M., Paquin, C. E. (1987). "Homology of Saccharomyces cerevisiae ADH4 to an iron-activated alcohol dehydrogenase from Zymomonas mobilis." Mol Gen Genet 209:374-381.2823079
  • Coissac, E., Maillier, E., Robineau, S., Netter, P. (1996). "Sequence of a 39,411 bp DNA fragment covering the left end of chromosome VII of Saccharomyces cerevisiae." Yeast 12:1555-1562.8972578
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Drewke, C., Ciriacy, M. (1988). "Overexpression, purification and properties of alcohol dehydrogenase IV from Saccharomyces cerevisiae." Biochim Biophys Acta 950:54-60.3282541
  • Yuan, D. S. (2000). "Zinc-regulated genes in Saccharomyces cerevisiae revealed by transposon tagging." Genetics 156:45-58.10978274
  • Lyons, T. J., Gasch, A. P., Gaither, L. A., Botstein, D., Brown, P. O., Eide, D. J. (2000). "Genome-wide characterization of the Zap1p zinc-responsive regulon in yeast." Proc Natl Acad Sci U S A 97:7957-7962.10884426
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Bird, A. J., Gordon, M., Eide, D. J., Winge, D. R. (2006). "Repression of ADH1 and ADH3 during zinc deficiency by Zap1-induced intergenic RNA transcripts." EMBO J 25:5726-5734.17139254
  • Mizuno, A., Tabei, H., Iwahuti, M. (2006). "Characterization of low-acetic-acid-producing yeast isolated from 2-deoxyglucose-resistant mutants and its application to high-gravity brewing." J Biosci Bioeng 101:31-37.16503288
  • De Nicola, R., Hazelwood, L. A., De Hulster, E. A., Walsh, M. C., Knijnenburg, T. A., Reinders, M. J., Walker, G. M., Pronk, J. T., Daran, J. M., Daran-Lapujade, P. (2007). "Physiological and transcriptional responses of Saccharomyces cerevisiae to zinc limitation in chemostat cultures." Appl Environ Microbiol 73:7680-7692.17933919
  • Cheraiti, N., Sauvage, F. X., Salmon, J. M. (2008). "Acetaldehyde addition throughout the growth phase alleviates the phenotypic effect of zinc deficiency in Saccharomyces cerevisiae." Appl Microbiol Biotechnol 77:1093-1109.17938904