You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProline dehydrogenase, mitochondrial
Synonyms
  • Proline oxidase
Gene NamePUT1
Enzyme Class
Biological Properties
General FunctionInvolved in proline dehydrogenase activity
Specific FunctionConverts proline to delta-1-pyrroline-5-carboxylate
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB ReactionsNot Available
KEGG Reactions
L-Proline + NADNADH + 1-Pyrroline-5-carboxylic acid + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB002431-Pyrroline-5-carboxylic acidShow
YMDB00378L-ProlineShow
YMDB00412NAD(+)Show
YMDB004191-Pyrroline-5-carboxylateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
oxidoreductase activity, acting on the CH-NH group of donors
proline dehydrogenase activity
Process
glutamine family amino acid metabolic process
oxidation reduction
glutamate metabolic process
glutamate biosynthetic process
metabolic process
proline metabolic process
cellular metabolic process
proline catabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR142W
Gene Sequence>1431 bp ATGATAGCTTCCAAAAGCTCCTTATTAGTTACTAAATCGCGCATACCCTCTCTATGCTTT CCTTTGATAAAGAGGTCCTATGTGTCAAAGACTCCGACACACTCTAACACGGCTGCTAAT CTGATGGTTGAAACTCCGGCCGCCAATGCCAACGGCAATAGTGTGATGGCACCTCCTAAC TCAATCAATTTTCTACAGACACTTCCCAAGAAGGAACTATTCCAACTGGGATTCATCGGT ATTGCGACCTTGAACAGCTTCTTCCTGAACACGATCATTAAGTTGTTCCCTTACATCCCC ATCCCAGTAATAAAATTCTTCGTCTCTTCTTTATACTGTGGCGGTGAGAACTTTAAAGAG GTCATCGAATGCGGCAAACGTCTGCAGAAGAGAGGTATATCGAACATGATGCTTTCATTA ACTATTGAAAATTCCGAAGGTACAAAGAGTTTGTCCAGTACTCCAGTAGACCAAATTGTC AAGGAAACAATCAGCTCTGTCCACAACATCCTACTGCCCAATATTATTGGCCAGCTGGAA TCTAAGCCAATCAATGACATTGCTCCAGGTTATATCGCTCTAAAACCCTCTGCTTTGGTC GATAACCCTCACGAGGTTCTGTACAATTTCAGTAATCCCGCCTACAAGGCTCAAAGGGAT CAGCTGATCGAGAACTGCTCTAAGATTACAAAAGAGATTTTTGAACTAAATCAATCTTTG TTAAAGAAGTACCCTGAAAGAAAGGCCCCATTTATGGTTTCCACTATTGACGCTGAGAAG TATGATTTGCAGGAGAATGGTGTTTACGAATTACAGAGAATCTTATTTCAAAAATTCAAT CCCACTTCATCTAAACTGATATCATGTGTCGGTACTTGGCAGTTGTACCTAAGGGACTCT GGTGACCATATTTTGCACGAATTGAAGCTGGCCCAAGAAAACGGCTATAAGCTTGGGCTG AAACTGGTTCGTGGTGCTTATATTCATTCTGAAAAAAACCGTAACCAAATTATCTTTGGC GATAAAACGGGCACTGACGAAAATTACGATCGTATCATCACTCAAGTTGTCAATGATTTA ATCATCAATGGCGAGGATTCTTATTTTGGTCACTTGGTTGTCGCCTCTCATAATTACCAA TCCCAAATGCTCGTTACTAATTTGCTAAAATCTACCCAAGACAACTCTTATGCCAAATCG AACATTGTGTTGGGGCAATTACTAGGTATGGCAGATAATGTTACCTATGACCTAATTACC AACCATGGCGCTAAAAACATAATCAAGTATGTCCCATGGGGCCCACCATTGGAAACTAAA GATTATCTTTTGAGAAGATTGCAAGAAAACGGGGATGCTGTGAGATCTGATAATGGCTGG CCATTAATCAAGGCCATAGCAAAGTCGATTCCAAAAAGAGTAGGCCTATGA
Protein Properties
Pfam Domain Function
Protein Residues476
Protein Molecular Weight53270.89844
Protein Theoretical pI9.31
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Proline dehydrogenase, mitochondrial MIASKSSLLVTKSRIPSLCFPLIKRSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPN SINFLQTLPKKELFQLGFIGIATLNSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKE VIECGKRLQKRGISNMMLSLTIENSEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQLE SKPINDIAPGYIALKPSALVDNPHEVLYNFSNPAYKAQRDQLIENCSKITKEIFELNQSL LKKYPERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDS GDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDL IINGEDSYFGHLVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLIT NHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRSDNGWPLIKAIAKSIPKRVGL
References
External Links
ResourceLink
Saccharomyces Genome Database PUT1
Uniprot IDP09368
Uniprot NamePUT1_YEAST
GenBank Gene IDAY692906
Genebank Protein ID51013263
General Reference
  • Wang, S. S., Brandriss, M. C. (1987). "Proline utilization in Saccharomyces cerevisiae: sequence, regulation, and mitochondrial localization of the PUT1 gene product." Mol Cell Biol 7:4431-4440.3125423
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106