You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOrnithine aminotransferase
Synonyms
  • Ornithine--oxo-acid aminotransferase
Gene NameCAR2
Enzyme Class
Biological Properties
General FunctionInvolved in transaminase activity
Specific FunctionL-ornithine + a 2-oxo acid = L-glutamate 5- semialdehyde + an L-amino acid
Cellular LocationCytoplasm
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
Ornithine + Oxoglutaric acidL-Glutamic acid + l-Glutamic-gamma-semialdehyde
KEGG Reactions
Oxoglutaric acid + OrnithineL-Glutamic acid + l-Glutamic-gamma-semialdehyde
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00353OrnithineShow
YMDB00918l-Glutamic-gamma-semialdehydeShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
binding
transferase activity, transferring nitrogenous groups
transaminase activity
cofactor binding
pyridoxal phosphate binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLR438W
Gene Sequence>1275 bp ATGTCCGAAGCTACCCTCTCCTCCAAGCAAACCATTGAATGGGAAAACAAATACTCCGCC CACAACTACCACCCCTTGCCCGTCGTTTTTCACAAGGCTAAGGGCGCACATGTGTGGGAC CCGGAGGGTAAGCTGTACCTCGACTTCCTGAGCGCTTATTCTGCCGTCAACCAGGGCCAT TGCCATCCTCACATCATCAAGGCTTTGACGGAGCAAGCACAAACACTAACATTGTCCTCC AGAGCGTTCCACAACGATGTTTACGCGCAATTCGCCAAGTTCGTGACCGAATTCTTCGGG TTCGAAACCGTTTTGCCCATGAACACCGGTGCAGAAGCCGTGGAAACTGCTTTGAAGTTG GCCAGAAGATGGGGGTACATGAAGAAGAACATCCCTCAAGATAAAGCCATCATTCTGGGT GCCGAGGGTAACTTCCACGGGAGAACCTTCGGTGCTATCAGTTTGAGTACCGACTACGAG GACTCCAAGTTGCATTTCGGGCCTTTCGTGCCTAACGTTGCCAGTGGTCACTCCGTGCAC AAGATCAGATACGGCCACGCAGAAGATTTCGTCCCTATCTTGGAATCTCCTGAAGGTAAG AACGTTGCCGCCATCATTCTAGAGCCAATTCAGGGTGAAGCCGGTATCGTCGTGCCCCCC GCAGACTACTTCCCAAAGGTCTCCGCATTATGCCGTAAGCACAACGTCCTATTGATCGTT GACGAAATTCAAACCGGTATCGGTAGAACCGGTGAGTTGCTTTGCTACGACCACTACAAG GCAGAGGCCAAGCCTGATATTGTTTTGTTAGGTAAGGCTCTCTCAGGTGGTGTTCTTCCC GTCTCATGTGTTCTGTCTTCTCACGACATCATGTCTTGCTTTACCCCAGGATCTCACGGT TCTACTTTCGGCGGTAATCCTTTGGCTTCCCGCGTTGCCATCGCCGCCCTCGAGGTCATC CGCGACGAGAAGCTGTGCCAAAGAGCCGCCCAACTGGGTAGCTCTTTCATCGCCCAATTG AAAGCTCTCCAAGCCAAATCTAACGGTATAATCTCTGAGGTGCGTGGTATGGGACTGCTT ACCGCCATCGTAATCGACCCATCCAAGGCCAATGGTAAGACCGCTTGGGACTTGTGTCTA TTGATGAAGGATCACGGCCTCTTGGCTAAGCCCACCCACGACCACATCATCAGATTGGCT CCTCCTTTGGTCATCTCCGAAGAGGACTTGCAAACCGGTGTCGAAACCATTGCCAAGTGT ATCGATCTGTTATAA
Protein Properties
Pfam Domain Function
Protein Residues424
Protein Molecular Weight46085.60156
Protein Theoretical pI6.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ornithine aminotransferase MSEATLSSKQTIEWENKYSAHNYHPLPVVFHKAKGAHVWDPEGKLYLDFLSAYSAVNQGH CHPHIIKALTEQAQTLTLSSRAFHNDVYAQFAKFVTEFFGFETVLPMNTGAEAVETALKL ARRWGYMKKNIPQDKAIILGAEGNFHGRTFGAISLSTDYEDSKLHFGPFVPNVASGHSVH KIRYGHAEDFVPILESPEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIV DEIQTGIGRTGELLCYDHYKAEAKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPGSHG STFGGNPLASRVAIAALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMGLL TAIVIDPSKANGKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPLVISEEDLQTGVETIAKC IDLL
References
External Links
ResourceLink
Saccharomyces Genome Database CAR2
Uniprot IDP07991
Uniprot NameOAT_YEAST
GenBank Gene IDU21094
Genebank Protein ID665969
General Reference
  • Degols, G. (1987). "Functional analysis of the regulatory region adjacent to the cargB gene of Saccharomyces cerevisiae. Nucleotide sequence, gene fusion experiments and cis-dominant regulatory mutation analysis." Eur J Biochem 169:193-200.2824201
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Degols, G., Jauniaux, J. C., Wiame, J. M. (1987). "Molecular characterization of transposable-element-associated mutations that lead to constitutive L-ornithine aminotransferase expression in Saccharomyces cerevisiae." Eur J Biochem 165:289-296.3036506
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106