You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameL-aminoadipate-semialdehyde dehydrogenase
Synonyms
  • Alpha-aminoadipate reductase
  • Alpha-AR
Gene NameLYS2
Enzyme Class
Biological Properties
General FunctionInvolved in ligase activity
Specific FunctionCatalyzes the activation of alpha-aminoadipate by ATP- dependent adenylation and the reduction of activated alpha- aminoadipate by NADPH
Cellular LocationNot Available
SMPDB Pathways
lysine metabolismPW002420 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lysine biosynthesisec00300 Map00300
Lysine degradationec00310 Map00310
SMPDB Reactions
Aminoadipic acid + Adenosine triphosphate + holo-[LYS2 peptidyl-carrier-protein] → Pyrophosphate + Adenosine monophosphate + L-2-aminoadipyl-[LYS2 peptidyl-carrier-protein]
hydron + NADPH + L-2-aminoadipyl-[LYS2 peptidyl-carrier-protein] → NADP + holo-[LYS2 peptidyl-carrier-protein] + Allysine
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00219PyrophosphateShow
YMDB00305Aminoadipic acidShow
YMDB00346AllysineShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00721L-AllysineShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00999L-2-aminoadipateShow
GO Classification
Component
Not Available
Function
cofactor binding
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
catalytic activity
phosphopantetheine binding
substrate-specific transporter activity
ligase activity
acyl carrier activity
L-aminoadipate-semialdehyde dehydrogenase activity
binding
carboxylic acid binding
amino acid binding
oxidoreductase activity
transporter activity
Process
aspartate family amino acid metabolic process
metabolic process
cellular metabolic process
lysine metabolic process
cellular amino acid and derivative metabolic process
lysine biosynthetic process
cellular amino acid metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 2
LocusYBR115C
Gene Sequence>4179 bp ATGACTAACGAAAAGGTCTGGATAGAGAAGTTGGATAATCCAACTCTTTCAGTGTTACCA CATGACTTTTTACGCCCACAACAAGAACCTTATACGAAACAAGCTACATATTCGTTACAG CTACCTCAGCTCGATGTGCCTCATGATAGTTTTTCTAACAAATACGCTGTCGCTTTGAGT GTATGGGCTGCATTGATATATAGAGTAACCGGTGACGATGATATTGTTCTTTATATTGCG AATAACAAAATCTTAAGATTCAATATTCAACCAACGTGGTCATTTAATGAGCTGTATTCT ACAATTAACAATGAGTTGAACAAGCTCAATTCTATTGAGGCCAATTTTTCCTTTGACGAG CTAGCTGAAAAAATTCAAAGTTGCCAAGATCTGGAAAGGACCCCTCAGTTGTTCCGTTTG GCCTTTTTGGAAAACCAAGATTTCAAATTAGACGAGTTCAAGCATCATTTAGTGGACTTT GCTTTGAATTTGGATACCAGTAATAATGCGCATGTTTTGAACTTAATTTATAACAGCTTA CTGTATTCGAATGAAAGAGTAACCATTGTTGCGGACCAATTTACTCAATATTTGACTGCT GCGCTAAGCGATCCATCCAATTGCATAACTAAAATCTCTCTGATCACCGCATCATCCAAG GATAGTTTACCTGATCCAACTAAGAACTTGGGCTGGTGCGATTTCGTGGGGTGTATTCAC GACATTTTCCAGGACAATGCTGAAGCCTTCCCAGAGAGAACCTGTGTTGTGGAGACTCCA ACACTAAATTCCGACAAGTCCCGTTCTTTCACTTATCGCGACATCAACCGCACTTCTAAC ATAGTTGCCCATTATTTGATTAAAACAGGTATCAAAAGAGGTGATGTAGTGATGATCTAT TCTTCTAGGGGTGTGGATTTGATGGTATGTGTGATGGGTGTCTTGAAAGCCGGCGCAACC TTTTCAGTTATCGACCCTGCATATCCCCCAGCCAGACAAACCATTTACTTAGGTGTTGCT AAACCACGTGGGTTGATTGTTATTAGAGCTGCTGGACAATTGGATCAACTAGTAGAAGAT TACATCAATGATGAATTGGAGATTGTTTCAAGAATCAATTCCATCGCTATTCAAGAAAAT GGTACCATTGAAGGTGGCAAATTGGACAATGGCGAGGATGTTTTGGCTCCATATGATCAC TACAAAGACACCAGAACAGGTGTTGTAGTTGGACCAGATTCCAACCCAACCCTATCTTTC ACATCTGGTTCCGAAGGTATTCCTAAGGGTGTTCTTGGTAGACATTTTTCCTTGGCTTAT TATTTCAATTGGATGTCCAAAAGGTTCAACTTAACAGAAAATGATAAATTCACAATGCTG AGCGGTATTGCACATGATCCAATTCAAAGAGATATGTTTACACCATTATTTTTAGGTGCC CAATTGTATGTCCCTACTCAAGATGATATTGGTACACCGGGCCGTTTAGCGGAATGGATG AGTAAGTATGGTTGCACAGTTACCCATTTAACACCTGCCATGGGTCAATTACTTACTGCC CAAGCTACTACACCATTCCCTAAGTTACATCATGCGTTCTTTGTGGGTGACATTTTAACA AAACGTGATTGTCTGAGGTTACAAACCTTGGCAGAAAATTGCCGTATTGTTAATATGTAC GGTACCACTGAAACACAGCGTGCAGTTTCTTATTTCGAAGTTAAATCAAAAAATGACGAT CCAAACTTTTTGAAAAAATTGAAAGATGTCATGCCTGCTGGTAAAGGTATGTTGAACGTT CAGCTACTAGTTGTTAACAGGAACGATCGTACTCAAATATGTGGTATTGGCGAAATAGGT GAGATTTATGTTCGTGCAGGTGGTTTGGCCGAAGGTTATAGAGGATTACCAGAATTGAAT AAAGAAAAATTTGTGAACAACTGGTTTGTTGAAAAAGATCACTGGAATTATTTGGATAAG GATAATGGTGAACCTTGGAGACAATTCTGGTTAGGTCCAAGAGATAGATTGTACAGAACG GGTGATTTAGGTCGTTATCTACCAAACGGTGACTGTGAATGTTGCGGTAGGGCTGATGAT CAAGTTAAAATTCGTGGGTTCAGAATCGAATTAGGAGAAATAGATACGCACATTTCCCAA CATCCATTGGTAAGAGAAAACATTACTTTAGTTCGCAAAAATGCCGACAATGAGCCAACA TTGATCACATTTATGGTCCCAAGATTTGACAAGCCAGATGACTTGTCTAAGTTCCAAAGT GATGTTCCAAAGGAGGTTGAAACTGACCCTATAGTTAAGGGCTTAATCGGTTACCATCTT TTATCCAAGGACATCAGGACTTTCTTAAAGAAAAGATTGGCTAGCTATGCTATGCCTTCC TTGATTGTGGTTATGGATAAACTACCATTGAATCCAAATGGTAAAGTTGATAAGCCTAAA CTTCAATTCCCAACTCCCAAGCAATTAAATTTGGTAGCTGAAAATACAGTTTCTGAAACT GACGACTCTCAGTTTACCAATGTTGAGCGCGAGGTTAGAGACTTATGGTTAAGTATATTA CCTACCAAGCCAGCATCTGTATCACCAGATGATTCGTTTTTCGATTTAGGTGGTCATTCT ATCTTGGCTACCAAAATGATTTTTACCTTAAAGAAAAAGCTGCAAGTTGATTTACCATTG GGCACAATTTTCAAGTATCCAACGATAAAGGCCTTTGCCGCGGAAATTGACAGAATTAAA TCATCGGGTGGATCATCTCAAGGTGAGGTCGTCGAAAATGTCACTGCAAATTATGCGGAA GACGCCAAGAAATTGGTTGAGACGCTACCAAGTTCGTACCCCTCTCGAGAATATTTTGTT GAACCTAATAGTGCCGAAGGAAAAACAACAATTAATGTGTTTGTTACCGGTGTCACAGGA TTTCTGGGCTCCTACATCCTTGCAGATTTGTTAGGACGTTCTCCAAAGAACTACAGTTTC AAAGTGTTTGCCCACGTCAGGGCCAAGGATGAAGAAGCTGCATTTGCAAGATTACAAAAG GCAGGTATCACCTATGGTACTTGGAACGAAAAATTTGCCTCAAATATTAAAGTTGTATTA GGCGATTTATCTAAAAGCCAATTTGGTCTTTCAGATGAGAAGTGGATGGATTTGGCAAAC ACAGTTGATATAATTATCCATAATGGTGCGTTAGTTCACTGGGTTTATCCATATGCCAAA TTGAGGGATCCAAATGTTATTTCAACTATCAATGTTATGAGCTTAGCCGCCGTCGGCAAG CCAAAGTTCTTTGACTTTGTTTCCTCCACTTCTACTCTTGACACTGAATACTACTTTAAT TTGTCAGATAAACTTGTTAGCGAAGGGAAGCCAGGCATTTTAGAATCAGACGATTTAATG AACTCTGCAAGCGGGCTCACTGGTGGATATGGTCAGTCCAAATGGGCTGCTGAGTACATC ATTAGACGTGCAGGTGAAAGGGGCCTACGTGGGTGTATTGTCAGACCAGGTTACGTAACA GGTGCCTCTGCCAATGGTTCTTCAAACACAGATGATTTCTTATTGAGATTTTTGAAAGGT TCAGTCCAATTAGGTAAGATTCCAGATATCGAAAATTCCGTGAATATGGTTCCAGTAGAT CATGTTGCTCGTGTTGTTGTTGCTACGTCTTTGAATCCTCCCAAAGAAAATGAATTGGCC GTTGCTCAAGTAACGGGTCACCCAAGAATATTATTCAAAGACTACTTGTATACTTTACAC GATTATGGTTACGATGTCGAAATCGAAAGCTATTCTAAATGGAAGAAATCATTGGAGGCG TCTGTTATTGACAGGAATGAAGAAAATGCGTTGTATCCTTTGCTACACATGGTCTTAGAC AACTTACCTGAAAGTACCAAAGCTCCGGAACTAGACGATAGGAACGCCGTGGCATCTTTA AAGAAAGACACCGCATGGACAGGTGTTGATTGGTCTAATGGAATAGGTGTTACTCCAGAA GAGGTTGGTATATATATTGCATTTTTAAACAAGGTTGGATTTTTACCTCCACCAACTCAT AATGACAAACTTCCACTGCCAAGTATAGAACTAACTCAAGCGCAAATAAGTCTAGTTGCT TCAGGTGCTGGTGCTCGTGGAAGCTCCGCAGCAGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues1392
Protein Molecular Weight155344.0
Protein Theoretical pI5.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>L-aminoadipate-semialdehyde dehydrogenase MTNEKVWIEKLDNPTLSVLPHDFLRPQQEPYTKQATYSLQLPQLDVPHDSFSNKYAVALS VWAALIYRVTGDDDIVLYIANNKILRFNIQPTWSFNELYSTINNELNKLNSIEANFSFDE LAEKIQSCQDLERTPQLFRLAFLENQDFKLDEFKHHLVDFALNLDTSNNAHVLNLIYNSL LYSNERVTIVADQFTQYLTAALSDPSNCITKISLITASSKDSLPDPTKNLGWCDFVGCIH DIFQDNAEAFPERTCVVETPTLNSDKSRSFTYRDINRTSNIVAHYLIKTGIKRGDVVMIY SSRGVDLMVCVMGVLKAGATFSVIDPAYPPARQTIYLGVAKPRGLIVIRAAGQLDQLVED YINDELEIVSRINSIAIQENGTIEGGKLDNGEDVLAPYDHYKDTRTGVVVGPDSNPTLSF TSGSEGIPKGVLGRHFSLAYYFNWMSKRFNLTENDKFTMLSGIAHDPIQRDMFTPLFLGA QLYVPTQDDIGTPGRLAEWMSKYGCTVTHLTPAMGQLLTAQATTPFPKLHHAFFVGDILT KRDCLRLQTLAENCRIVNMYGTTETQRAVSYFEVKSKNDDPNFLKKLKDVMPAGKGMLNV QLLVVNRNDRTQICGIGEIGEIYVRAGGLAEGYRGLPELNKEKFVNNWFVEKDHWNYLDK DNGEPWRQFWLGPRDRLYRTGDLGRYLPNGDCECCGRADDQVKIRGFRIELGEIDTHISQ HPLVRENITLVRKNADNEPTLITFMVPRFDKPDDLSKFQSDVPKEVETDPIVKGLIGYHL LSKDIRTFLKKRLASYAMPSLIVVMDKLPLNPNGKVDKPKLQFPTPKQLNLVAENTVSET DDSQFTNVEREVRDLWLSILPTKPASVSPDDSFFDLGGHSILATKMIFTLKKKLQVDLPL GTIFKYPTIKAFAAEIDRIKSSGGSSQGEVVENVTANYAEDAKKLVETLPSSYPSREYFV EPNSAEGKTTINVFVTGVTGFLGSYILADLLGRSPKNYSFKVFAHVRAKDEEAAFARLQK AGITYGTWNEKFASNIKVVLGDLSKSQFGLSDEKWMDLANTVDIIIHNGALVHWVYPYAK LRDPNVISTINVMSLAAVGKPKFFDFVSSTSTLDTEYYFNLSDKLVSEGKPGILESDDLM NSASGLTGGYGQSKWAAEYIIRRAGERGLRGCIVRPGYVTGASANGSSNTDDFLLRFLKG SVQLGKIPDIENSVNMVPVDHVARVVVATSLNPPKENELAVAQVTGHPRILFKDYLYTLH DYGYDVEIESYSKWKKSLEASVIDRNEENALYPLLHMVLDNLPESTKAPELDDRNAVASL KKDTAWTGVDWSNGIGVTPEEVGIYIAFLNKVGFLPPPTHNDKLPLPSIELTQAQISLVA SGAGARGSSAAA
References
External Links
ResourceLink
Saccharomyces Genome Database LYS2
Uniprot IDP07702
Uniprot NameLYS2_YEAST
GenBank Gene IDM36287
Genebank Protein ID171867
General Reference
  • Morris, M. E., Jinks-Robertson, S. (1991). "Nucleotide sequence of the LYS2 gene of Saccharomyces cerevisiae: homology to Bacillus brevis tyrocidine synthetase 1." Gene 98:141-145.2013406
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Fleig, U. N., Pridmore, R. D., Philippsen, P. (1986). "Construction of LYS2 cartridges for use in genetic manipulations of Saccharomyces cerevisiae." Gene 46:237-245.3542721
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1992). "Molecular analysis of yeast chromosome II between CMD1 and LYS2: the excision repair gene RAD16 located in this region belongs to a novel group of double-finger proteins." Yeast 8:397-408.1626431
  • Schaaff-Gerstenschlager, I., Mannhaupt, G., Vetter, I., Zimmermann, F. K., Feldmann, H. (1993). "TKL2, a second transketolase gene of Saccharomyces cerevisiae. Cloning, sequence and deletion analysis of the gene." Eur J Biochem 217:487-492.7916691
  • Ehmann, D. E., Gehring, A. M., Walsh, C. T. (1999). "Lysine biosynthesis in Saccharomyces cerevisiae: mechanism of alpha-aminoadipate reductase (Lys2) involves posttranslational phosphopantetheinylation by Lys5." Biochemistry 38:6171-6177.10320345
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956