You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAnthranilate phosphoribosyltransferase
SynonymsNot Available
Gene NameTRP4
Enzyme Class
Biological Properties
General FunctionInvolved in anthranilate phosphoribosyltransferase activity
Specific FunctionN-(5-phospho-D-ribosyl)-anthranilate + diphosphate = anthranilate + 5-phospho-alpha-D-ribose 1- diphosphate
Cellular LocationNot Available
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
2-Aminobenzoic acid + Phosphoribosyl pyrophosphatePyrophosphate + N-(5-Phosphonato-beta-D-ribosyl)anthranilate
KEGG Reactions
2-Aminobenzoic acid + Phosphoribosyl pyrophosphatePyrophosphate + N-(5-phospho-beta-D-ribosyl)anthranilic acid
Metabolites
YMDB IDNameView
YMDB00054N-(5-phospho-beta-D-ribosyl)anthranilic acidShow
YMDB00217N-(5-Phospho-beta-D-ribosyl)anthranilic acid (Duplicate)Show
YMDB00219PyrophosphateShow
YMDB002782-Aminobenzoic acidShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB01005N-(5-Phosphonato-beta-D-ribosyl)anthranilateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity, transferring pentosyl groups
transferase activity
transferase activity, transferring glycosyl groups
anthranilate phosphoribosyltransferase activity
Process
tryptophan metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
tryptophan biosynthetic process
metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
indolalkylamine metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR354W
Gene Sequence>1143 bp ATGTCCGAGGCGACTTTGCTATCTTACACCAAGAAATTATTGGCTTCTCCGCCGCAATTG AGTAGCACAGACCTACACGATGCGTTGCTGGTTATATTAAGTCTTTTGCAAAAATGTGAT ACAAATAGCGATGAGAGTCTTTCCATCTATACCAAAGTTTCGAGTTTTCTCACGGCCTTG AGAGTTACTAAACTTGATCACAAGGCTGAATACATTGCGGAAGCTGCAAAGGCTGTGCTC AGACATTCCGACCTTGTTGATCTACCTTTACCCAAGAAGGACGAATTACACCCGGAAGAT GGACCAGTAATCTTAGATATTGTAGGTACTGGTGGTGACGGACAGAATACTTTTAATGTT TCCACGTCTGCTGCTATCGTTGCCTCCGGAATTCAGGGCCTAAAAATTTGTAAGCACGGT GGTAAAGCTTCTACATCCAATAGTGGAGCTGGTGACCTAATTGGAACTTTAGGCTGTGAC ATGTTCAAGGTTAATTCATCGACAGTGCCCAAACTTTGGCCTGATAATACGTTCATGTTT CTACTTGCTCCTTTTTTTCATCATGGAATGGGCCACGTTTCTAAGATACGCAAATTTCTT GGAATTCCGACTGTTTTCAACGTACTGGGACCACTTCTACATCCAGTTAGCCACGTAAAC AAGAGAATATTGGGCGTTTACTCAAAGGAACTTGCGCCTGAATATGCCAAGGCAGCCGCT TTGGTATATCCAGGAAGCGAAACTTTTATAGTTTGGGGACATGTTGGGTTAGACGAAGTA TCACCTATAGGCAAAACTACTGTCTGGCATATTGATCCGACATCGTCCGAACTTAAATTG AAGACCTTCCAATTAGAACCTTCTATGTTTGGTTTAGAAGAACACGAGTTGTCGAAGTGT GCTTCATACGGCCCTAAAGAGAATGCGAGAATTCTAAAAGAAGAAGTCTTGTCCGGCAAG TACCACCTTGGCGACAATAATCCTATTTATGACTACATCTTGATGAACACCGCCGTGTTA TATTGTTTAAGCCAAGGTCACCAGAACTGGAAGGAAGGGATCATTAAGGCAGAAGAAAGC ATACATTCTGGTAATGCATTACGTTCTTTAGAACACTTTATAGATAGTGTGAGCTCCTTG TAG
Protein Properties
Pfam Domain Function
Protein Residues380
Protein Molecular Weight41374.0
Protein Theoretical pI6.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Anthranilate phosphoribosyltransferase MSEATLLSYTKKLLASPPQLSSTDLHDALLVILSLLQKCDTNSDESLSIYTKVSSFLTAL RVTKLDHKAEYIAEAAKAVLRHSDLVDLPLPKKDELHPEDGPVILDIVGTGGDGQNTFNV STSAAIVASGIQGLKICKHGGKASTSNSGAGDLIGTLGCDMFKVNSSTVPKLWPDNTFMF LLAPFFHHGMGHVSKIRKFLGIPTVFNVLGPLLHPVSHVNKRILGVYSKELAPEYAKAAA LVYPGSETFIVWGHVGLDEVSPIGKTTVWHIDPTSSELKLKTFQLEPSMFGLEEHELSKC ASYGPKENARILKEEVLSGKYHLGDNNPIYDYILMNTAVLYCLSQGHQNWKEGIIKAEES IHSGNALRSLEHFIDSVSSL
References
External Links
ResourceLink
Saccharomyces Genome Database TRP4
Uniprot IDP07285
Uniprot NameTRPD_YEAST
GenBank Gene IDU28372
Genebank Protein ID849174
General Reference
  • Furter, R., Paravicini, G., Aebi, M., Braus, G., Prantl, F., Niederberger, P., Hutter, R. (1986). "The TRP4 gene of Saccharomyces cerevisiae: isolation and structural analysis." Nucleic Acids Res 14:6357-6373.2428012
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Kilmartin, J. V., Dyos, S. L., Kershaw, D., Finch, J. T. (1993). "A spacer protein in the Saccharomyces cerevisiae spindle poly body whose transcript is cell cycle-regulated." J Cell Biol 123:1175-1184.7503995
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106