You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3',5'-cyclic-nucleotide phosphodiesterase 2
Synonyms
  • PDEase 2
  • High-affinity cAMP phosphodiesterase
Gene NamePDE2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionControls the level of cAMP in yeast cells, together with the low-affinity cAMP phosphodiesterase (PDE1)
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
3',5'-cyclic AMP + waterAdenosine monophosphate + hydron
3',5'-cyclic dAMP + waterdAMP + hydron
water + 3',5'-cyclic IMPInosinic acid + hydron
water + 3',5'-cyclic GMPGuanosine monophosphate + hydron
water + 3',5'-cyclic CMPCytidine monophosphate + hydron
Metabolites
YMDB IDNameView
YMDB000233',5'-cyclic AMPShow
YMDB00097Adenosine monophosphateShow
YMDB00244Cyclic AMPShow
YMDB00261Guanosine monophosphateShow
YMDB00352Inosinic acidShow
YMDB00406Cytidine monophosphateShow
YMDB00451dAMPShow
YMDB004523',5'-cyclic dAMPShow
YMDB004533',5'-cyclic IMPShow
YMDB004543',5'-cyclic GMPShow
YMDB004553',5'-cyclic CMPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
cyclic-nucleotide phosphodiesterase activity
catalytic activity
3',5'-cyclic-nucleotide phosphodiesterase activity
hydrolase activity
hydrolase activity, acting on ester bonds
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Gene Properties
Chromosome Locationchromosome 15
LocusYOR360C
Gene Sequence>1581 bp ATGTCCACCCTTTTTCTGATTGGAATACACGAGATTGAGAAATCTCAAACAATTGTACAG AATGAACACTATTTTGATAGAGTGATTGAGCTTCAAGATTTGGATTCTCTGATGGTAGCA TTGTATAAGGACAGAGTTTCGCCTTTTCCAAACGTCCATAACTTTGAAACGGGCGTATCT ATAGTTCTTTATGACCCTTCAAAATTTCAATTATCTGTGCGACAATTGGATGTTCTATTC AAGGGATTTTTCCCATCTTTCAATATTTCTGCGATAGATCATACACGAGAGGAAAACCTG CAACGTCTGGAATGTGTTGAGCGTGAAAATAGCATCTGTCGTAATAGAATAACGAGAATT AACCACTGGATGTATCACCATCATGATGATACTCCAGACGGTATTAACAAAAACAGCTAT GGTACTGTAAATGGGAATTCTGTCCCCACTCAAGCATGTGAAGCAAACATTTACACTTTA TTATTGCATTTGAATGATTCCAAGGCACAACATTTACGAAAGGCATCAGTGCCAAGGCTA ATTCGCAACATCGAGTTTATGTCTTTTTTGTCAGATCCAATAGAAAAAATTTCTCAAGAG GGATCACATTATTGGAACATTCTATCAACTTGGGACTTTTGTGCTTTATCATTAAGCACT CAAGAATTGATTTGGTGCGGGTTCACGCTTATCAAAAAATTATCTAAGGATGCAAAAGTA CTCATTGCAGATAATAAGTTACTGCTACTACTATTTACTTTAGAATCATCCTATCATCAA GTTAACAAATTTCACAATTTTAGGCATGCCATCGATGTCATGCAAGCCACATGGCGATTG TGTACATATCTTCTTAAAGATAATCCTGTACAAACATTACTGTTGTGTATGGCTGCCATA GGTCATGATGTCGGTCATCCTGGGACTAACAATCAACTATTGTGCAACTGTGAATCAGAG GTTGCTCAAAATTTCAAAAATGTCTCTATCTTGGAGAATTTTCACAGGGAATTATTTCAA CAATTGCTATCAGAGCATTGGCCTCTTAAGCTCTCTATCTCCAAAAAAAAATTTGATTTT ATTTCCGAGGCTATTCTGGCCACAGATATGGCATTGCATTCTCAGTATGAGGATAGATTA ATGCATGAAAACCCAATGAAACAAATCACTTTGATATCTCTAATTATTAAAGCTGCAGAC ATCTCTAATGTGACGAGAACCTTGTCAATATCAGCACGTTGGGCATACCTCATTACTCTC GAATTTAATGATTGCGCTCTTTTGGAAACATTTCATAAAGCTCACCGCCCAGAACAAGAC TGTTTTGGCGATTCATACAAGAATGTTGATTCTCCGAAAGAAGATTTGGAATCAATTCAA AATATTTTGGTGAACGTAACAGACCCTGATGATATTATCAAAGACCATCCGCATATTCCA AACGGTCAAATATTTTTCATTAATACGTTTGCTGAAGTATTTTTCAACGCATTAAGTCAA AAATTCTCAGGATTAAAATTTTTAAGCGATAATGTCAAAATCAATAAAGAATACTGGATG AAACACAAGAAACCACAATAG
Protein Properties
Pfam Domain Function
Protein Residues526
Protein Molecular Weight60999.19922
Protein Theoretical pI6.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3',5'-cyclic-nucleotide phosphodiesterase 2 MSTLFLIGIHEIEKSQTIVQNEHYFDRVIELQDLDSLMVALYKDRVSPFPNVHNFETGVS IVLYDPSKFQLSVRQLDVLFKRFFPSFNISAIDHTREENLQRLECVERENSICRNRITRI NHWMYHHHDDTPDGINKNSYGTVNGNSVPTQACEANIYTLLLHLNDSKAQHLRKASVPRL IRNIEFMSFLSDPIEKISQEGSHYWNILSTWDFCALSLSTQELIWCGFTLIKKLSKDAKV LIADNKLLLLLFTLESSYHQVNKFHNFRHAIDVMQATWRLCTYLLKDNPVQTLLLCMAAI GHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHRELFQQLLSEHWPQLLSISKKKFDF ISEAILATDMALHSQYEDRLMHENPMKQITLISLIIKAADISNVTRTLSISARWAYLITL EFNDCALLETFHKAHRPEQDCFGDSYKNVDSPKEDLESIQNILVNVTDPDDIIKDHPHIP NGQIFFINTFAEVFFNALSQKFSGLKFLSDNVKINKEYWMKHKKPQ
References
External Links
ResourceLink
Saccharomyces Genome Database PDE2
Uniprot IDP06776
Uniprot NamePDE2_YEAST
GenBank Gene IDM14563
Genebank Protein ID172106
General Reference
  • Sass, P., Field, J., Nikawa, J., Toda, T., Wigler, M. (1986). "Cloning and characterization of the high-affinity cAMP phosphodiesterase of Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 83:9303-9307.3025832
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106