Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3',5'-cyclic-nucleotide phosphodiesterase 2
Synonyms
  • PDEase 2
  • High-affinity cAMP phosphodiesterase
Gene NamePDE2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionControls the level of cAMP in yeast cells, together with the low-affinity cAMP phosphodiesterase (PDE1)
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
3',5'-cyclic AMP + waterAdenosine monophosphate + hydron
3',5'-cyclic dAMP + waterdAMP + hydron
water + 3',5'-cyclic IMPInosinic acid + hydron
water + 3',5'-cyclic GMPGuanosine monophosphate + hydron
water + 3',5'-cyclic CMPCytidine monophosphate + hydron
Metabolites
YMDB IDNameView
YMDB000233',5'-cyclic AMPShow
YMDB00097Adenosine monophosphateShow
YMDB00244Cyclic AMPShow
YMDB00261Guanosine monophosphateShow
YMDB00352Inosinic acidShow
YMDB00406Cytidine monophosphateShow
YMDB00451dAMPShow
YMDB004523',5'-cyclic dAMPShow
YMDB004533',5'-cyclic IMPShow
YMDB004543',5'-cyclic GMPShow
YMDB004553',5'-cyclic CMPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
cyclic-nucleotide phosphodiesterase activity
3',5'-cyclic-nucleotide phosphodiesterase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Gene Properties
Chromosome Locationchromosome 15
LocusYOR360C
Gene Sequence>1581 bp ATGTCCACCCTTTTTCTGATTGGAATACACGAGATTGAGAAATCTCAAACAATTGTACAG AATGAACACTATTTTGATAGAGTGATTGAGCTTCAAGATTTGGATTCTCTGATGGTAGCA TTGTATAAGGACAGAGTTTCGCCTTTTCCAAACGTCCATAACTTTGAAACGGGCGTATCT ATAGTTCTTTATGACCCTTCAAAATTTCAATTATCTGTGCGACAATTGGATGTTCTATTC AAGGGATTTTTCCCATCTTTCAATATTTCTGCGATAGATCATACACGAGAGGAAAACCTG CAACGTCTGGAATGTGTTGAGCGTGAAAATAGCATCTGTCGTAATAGAATAACGAGAATT AACCACTGGATGTATCACCATCATGATGATACTCCAGACGGTATTAACAAAAACAGCTAT GGTACTGTAAATGGGAATTCTGTCCCCACTCAAGCATGTGAAGCAAACATTTACACTTTA TTATTGCATTTGAATGATTCCAAGGCACAACATTTACGAAAGGCATCAGTGCCAAGGCTA ATTCGCAACATCGAGTTTATGTCTTTTTTGTCAGATCCAATAGAAAAAATTTCTCAAGAG GGATCACATTATTGGAACATTCTATCAACTTGGGACTTTTGTGCTTTATCATTAAGCACT CAAGAATTGATTTGGTGCGGGTTCACGCTTATCAAAAAATTATCTAAGGATGCAAAAGTA CTCATTGCAGATAATAAGTTACTGCTACTACTATTTACTTTAGAATCATCCTATCATCAA GTTAACAAATTTCACAATTTTAGGCATGCCATCGATGTCATGCAAGCCACATGGCGATTG TGTACATATCTTCTTAAAGATAATCCTGTACAAACATTACTGTTGTGTATGGCTGCCATA GGTCATGATGTCGGTCATCCTGGGACTAACAATCAACTATTGTGCAACTGTGAATCAGAG GTTGCTCAAAATTTCAAAAATGTCTCTATCTTGGAGAATTTTCACAGGGAATTATTTCAA CAATTGCTATCAGAGCATTGGCCTCTTAAGCTCTCTATCTCCAAAAAAAAATTTGATTTT ATTTCCGAGGCTATTCTGGCCACAGATATGGCATTGCATTCTCAGTATGAGGATAGATTA ATGCATGAAAACCCAATGAAACAAATCACTTTGATATCTCTAATTATTAAAGCTGCAGAC ATCTCTAATGTGACGAGAACCTTGTCAATATCAGCACGTTGGGCATACCTCATTACTCTC GAATTTAATGATTGCGCTCTTTTGGAAACATTTCATAAAGCTCACCGCCCAGAACAAGAC TGTTTTGGCGATTCATACAAGAATGTTGATTCTCCGAAAGAAGATTTGGAATCAATTCAA AATATTTTGGTGAACGTAACAGACCCTGATGATATTATCAAAGACCATCCGCATATTCCA AACGGTCAAATATTTTTCATTAATACGTTTGCTGAAGTATTTTTCAACGCATTAAGTCAA AAATTCTCAGGATTAAAATTTTTAAGCGATAATGTCAAAATCAATAAAGAATACTGGATG AAACACAAGAAACCACAATAG
Protein Properties
Pfam Domain Function
Protein Residues526
Protein Molecular Weight60999.19922
Protein Theoretical pI6.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3',5'-cyclic-nucleotide phosphodiesterase 2 MSTLFLIGIHEIEKSQTIVQNEHYFDRVIELQDLDSLMVALYKDRVSPFPNVHNFETGVS IVLYDPSKFQLSVRQLDVLFKRFFPSFNISAIDHTREENLQRLECVERENSICRNRITRI NHWMYHHHDDTPDGINKNSYGTVNGNSVPTQACEANIYTLLLHLNDSKAQHLRKASVPRL IRNIEFMSFLSDPIEKISQEGSHYWNILSTWDFCALSLSTQELIWCGFTLIKKLSKDAKV LIADNKLLLLLFTLESSYHQVNKFHNFRHAIDVMQATWRLCTYLLKDNPVQTLLLCMAAI GHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHRELFQQLLSEHWPQLLSISKKKFDF ISEAILATDMALHSQYEDRLMHENPMKQITLISLIIKAADISNVTRTLSISARWAYLITL EFNDCALLETFHKAHRPEQDCFGDSYKNVDSPKEDLESIQNILVNVTDPDDIIKDHPHIP NGQIFFINTFAEVFFNALSQKFSGLKFLSDNVKINKEYWMKHKKPQ
References
External Links
ResourceLink
Saccharomyces Genome Database PDE2
Uniprot IDP06776
Uniprot NamePDE2_YEAST
GenBank Gene IDM14563
Genebank Protein ID172106
General Reference
  • Sass, P., Field, J., Nikawa, J., Toda, T., Wigler, M. (1986). "Cloning and characterization of the high-affinity cAMP phosphodiesterase of Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 83:9303-9307.3025832
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106