You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameKetol-acid reductoisomerase, mitochondrial
Synonyms
  • Acetohydroxy-acid reductoisomerase
  • Alpha-keto-beta-hydroxylacil reductoisomerase
Gene NameILV5
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific Function(R)-2,3-dihydroxy-3-methylbutanoate + NADP(+) = (S)-2-hydroxy-2-methyl-3-oxobutanoate + NADPH
Cellular LocationMitochondrion
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
2-Dehydropantoic acid + NADPH + hydronNADP + (R)-Pantoic acid
NADPH + hydron + 2-Acetolactate NADP + (R)-2,3-Dihydroxy-isovalerate
NADPH + hydron + (S)-2-acetyl-2-hydroxybutanoateNADP + (R)-2,3-Dihydroxy-3-methylvalerate
Metabolites
YMDB IDNameView
YMDB00039(S)-2-Aceto-2-hydroxybutanoic acidShow
YMDB00063(R)-2,3-Dihydroxy-isovalerateShow
YMDB00068(R)-2,3-Dihydroxy-3-methylvalerateShow
YMDB000932-Dehydropantoic acidShow
YMDB00177(S)-2-AcetolactateShow
YMDB00376(R)-Pantoic acidShow
YMDB003942-Acetolactate Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00428(S)-2-acetyl-2-hydroxybutanoateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
ketol-acid reductoisomerase activity
binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
catalytic activity
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
coenzyme binding
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
branched chain family amino acid biosynthetic process
cellular amino acid metabolic process
oxidation reduction
metabolic process
cellular amino acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR355C
Gene Sequence>1188 bp ATGTTGAGAACTCAAGCCGCCAGATTGATCTGCAACTCCCGTGTCATCACTGCTAAGAGA ACCTTTGCTTTGGCCACCCGTGCTGCTGCTTACAGCAGACCAGCTGCCCGTTTCGTTAAG CCAATGATCACTACCCGTGGTTTGAAGCAAATCAACTTCGGTGGTACTGTTGAAACCGTC TACGAAAGAGCTGACTGGCCAAGAGAAAAGTTGTTGGACTACTTCAAGAACGACACTTTT GCTTTGATCGGTTACGGTTCCCAAGGTTACGGTCAAGGTTTGAACTTGAGAGACAACGGT TTGAACGTTATCATTGGTGTCCGTAAAGATGGTGCTTCTTGGAAGGCTGCCATCGAAGAC GGTTGGGTTCCAGGCAAGAACTTGTTCACTGTTGAAGATGCTATCAAGAGAGGTAGTTAC GTTATGAACTTGTTGTCCGATGCCGCTCAATCAGAAACCTGGCCTGCTATCAAGCCATTG TTGACCAAGGGTAAGACTTTGTACTTCTCCCACGGTTTCTCCCCAGTCTTCAAGGACTTG ACTCACGTTGAACCACCAAAGGACTTAGATGTTATCTTGGTTGCTCCAAAGGGTTCCGGT AGAACTGTCAGATCTTTGTTCAAGGAAGGTCGTGGTATTAACTCTTCTTACGCCGTCTGG AACGATGTCACCGGTAAGGCTCACGAAAAGGCCCAAGCTTTGGCCGTTGCCATTGGTTCC GGTTACGTTTACCAAACCACTTTCGAAAGAGAAGTCAACTCTGACTTGTACGGTGAAAGA GGTTGTTTAATGGGTGGTATCCACGGTATGTTCTTGGCTCAATACGACGTCTTGAGAGAA AACGGTCACTCCCCATCTGAAGCTTTCAACGAAACCGTCGAAGAAGCTACCCAATCTCTA TACCCATTGATCGGTAAGTACGGTATGGATTACATGTACGATGCTTGTTCCACCACCGCC AGAAGAGGTGCTTTGGACTGGTACCCAATCTTCAAGAATGCTTTGAAGCCTGTTTTCCAA GACTTGTACGAATCTACCAAGAACGGTACCGAAACCAAGAGATCTTTGGAATTCAACTCT CAACCTGACTACAGAGAAAAGCTAGAAAAGGAATTAGACACCATCAGAAACATGGAAATC TGGAAGGTTGGTAAGGAAGTCAGAAAGTTGAGACCAGAAAACCAATAA
Protein Properties
Pfam Domain Function
Protein Residues395
Protein Molecular Weight44368.10156
Protein Theoretical pI9.42
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ketol-acid reductoisomerase, mitochondrial MLRTQAARLICNSRVITAKRTFALATRAAAYSRPAARFVKPMITTRGLKQINFGGTVETV YERADWPREKLLDYFKNDTFALIGYGSQGYGQGLNLRDNGLNVIIGVRKDGASWKAAIED GWVPGKNLFTVEDAIKRGSYVMNLLSDAAQSETWPAIKPLLTKGKTLYFSHGFSPVFKDL THVEPPKDLDVILVAPKGSGRTVRSLFKEGRGINSSYAVWNDVTGKAHEKAQALAVAIGS GYVYQTTFEREVNSDLYGERGCLMGGIHGMFLAQYDVLRENGHSPSEAFNETVEEATQSL YPLIGKYGMDYMYDACSTTARRGALDWYPIFKNALKPVFQDLYESTKNGTETKRSLEFNS QPDYREKLEKELDTIRNMEIWKVGKEVRKLRPENQ
References
External Links
ResourceLink
Saccharomyces Genome Database ILV5
Uniprot IDP06168
Uniprot NameILV5_YEAST
GenBank Gene IDU19102
Genebank Protein ID609403
General Reference
  • Petersen, J. G., Holmberg, S. (1986). "The ILV5 gene of Saccharomyces cerevisiae is highly expressed." Nucleic Acids Res 14:9631-9651.3027658
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Shevchenko, A., Jensen, O. N., Podtelejnikov, A. V., Sagliocco, F., Wilm, M., Vorm, O., Mortensen, P., Shevchenko, A., Boucherie, H., Mann, M. (1996). "Linking genome and proteome by mass spectrometry: large-scale identification of yeast proteins from two dimensional gels." Proc Natl Acad Sci U S A 93:14440-14445.8962070
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956