You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
Synonyms
  • Cobalamin-independent methionine synthase
  • Delta-P8 protein
  • Methionine synthase, vitamin-B12 independent isozyme
Gene NameMET6
Enzyme Class
Biological Properties
General FunctionInvolved in 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity
Specific FunctionCatalyzes the transfer of a methyl group from 5- methyltetrahydrofolate to homocysteine resulting in methionine formation
Cellular LocationNot Available
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Selenocompound metabolismec00450 Map00450
SMPDB Reactions
Homocysteine + 5-Methyltetrahydropteroyltri-L-glutamateL-Methionine + Tetrahydropteroyltri-L-glutamate
Selenohomocysteine + 5-Methyltetrahydropteroyltri-L-glutamateSelenomethionine + Tetrahydropteroyltri-L-glutamate
KEGG Reactions
L-Homocysteine + 5-Methyltetrahydropteroyltri-L-glutamic acidL-Methionine + Tetrahydropteroyltri-L-glutamate
L-Homocysteine + 5-Methyltetrahydrofolic acidL-Methionine + 5,6,7,8-Tetrahydrofolic acid + hydron
Metabolites
YMDB IDNameView
YMDB00081Tetrahydropteroyltri-L-glutamateShow
YMDB002385-Methyltetrahydrofolic acidShow
YMDB00318L-MethionineShow
YMDB003285-Methyltetrahydropteroyltri-L-glutamateShow
YMDB00371HomocysteineShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB005185-Methyltetrahydropteroyltri-L-glutamic acidShow
YMDB00519Tetrahydropteroyltri-L-glutamic acidShow
YMDB00520L-HomocysteineShow
YMDB00862hydronShow
YMDB16175SelenomethionineShow
YMDB16178SelenohomocysteineShow
GO Classification
Component
Not Available
Function
transferase activity, transferring one-carbon groups
5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity
methyltransferase activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
catalytic activity
transferase activity
S-methyltransferase activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
sulfur amino acid metabolic process
sulfur amino acid biosynthetic process
metabolic process
methionine biosynthetic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER091C
Gene Sequence>2304 bp ATGGTTCAATCTGCTGTCTTAGGGTTCCCAAGAATCGGTCCAAACAGAGAATTAAAGAAG GCCACTGAAGGTTACTGGAACGGTAAAATCACTGTCGATGAATTATTCAAGGTCGGTAAG GATTTGAGAACTCAAAACTGGAAGTTGCAAAAGGAGGCTGGTGTTGATATCATCCCATCC AATGACTTCTCCTTTTACGACCAAGTTTTGGATTTGTCTTTGTTGTTCAATGTCATTCCA GACCGTTACACTAAGTACGATCTATCTCCAATCGACACTTTGTTTGCTATGGGTAGAGGT TTACAAAGAAAGGCCACTGAAACTGAAAAGGCTGTCGACGTCACTGCTTTGGAAATGGTT AAATGGTTCGACTCTAACTACCATTACGTTAGACCAACTTTCTCCAAGACCACTCAATTT AAGTTGAACGGCCAAAAGCCAGTTGACGAATTTTTGGAAGCCAAGGAGTTAGGTATTCAT ACTAGACCTGTCTTGTTGGGTCCAGTTTCTTACTTATTCTTGGGTAAGGCTGACAAGGAT TCTCTAGATTTGGAACCATTGTCCCTATTGGAACAATTGTTGCCTCTATACACTGAAATC CTATCTAAATTGGCTTCTGCTGGTGCCACTGAAGTTCAAATTGACGAACCTGTCTTAGTT TTGGACTTGCCTGCCAACGCCCAAGCCGCCATTAAGAAGGCTTACACTTACTTCGGTGAA CAAAGCAATCTACCAAAGATTACTTTGGCTACTTACTTCGGTACCGTTGTCCCTAACTTA GACGCCATCAAGGGCTTGCCAGTTGCTGCCTTACACGTTGACTTTGTTAGAGCTCCAGAA CAATTTGATGAAGTCGTTGCCGCCATTGGTAACAAACAAACCTTGTCTGTTGGTATTGTT GATGGTAGAAACATTTGGAAGAATGATTTCAAGAAGTCTTCCGCTATCGTTAACAAGGCT ATTGAAAAGTTGGGTGCTGACAGAGTCGTTGTTGCCACTTCTTCTTCTCTATTGCACACA CCAGTTGATTTGAACAACGAAACCAAGTTGGACGCTGAAATCAAGGGCTTTTTCTCTTTC GCCACTCAAAAATTGGATGAAGTTGTTGTGATCACCAAGAACGTTTCCGGTCAAGACGTT GCTGCTGCCCTAGAAGCTAACGCTAAATCTGTTGAATCCAGAGGTAAATCCAAGTTTATC CACGATGCTGCCGTTAAGGCCAGAGTTGCCTCTATCGACGAAAAAATGTCTACTAGAGCA GCTCCATTTGAACAAAGATTGCCTGAACAACAAAAAGTCTTCAACTTGCCATTGTTCCCA ACAACAACTATTGGTTCCTTCCCTCAAACCAAGGACATCAGAATTAACAGAAACAAATTC AACAAGGGTACCATCTCTGCTGAAGAATATGAAAAATTCATCAATTCTGAAATTGAAAAG GTCATCAGATTCCAAGAAGAAATTGGTTTGGATGTCTTAGTCCACGGTGAACCAGAAAGA AACGATATGGTTCAATACTTCGGTGAACAAATCAACGGTTATGCTTTCACTGTTAACGGT TGGGTTCAATCTTACGGTTCCAGATATGTCAGACCACCAATTATTGTTGGTGACTTGTCC AGACCAAAGGCTATGTCCGTCAAGGAATCTGTTTACGCTCAATCCATCACTTCTAAGCCA GTAAAGGGTATGTTGACTGGTCCAATTACCTGTTTGAGATGGTCTTTCCCAAGAGACGAT GTCGACCAAAAAACTCAAGCTATGCAATTAGCTTTGGCTTTGAGAGATGAAGTCAATGAT TTGGAAGCTGCCGGTATCAAGGTTATCCAAGTTGATGAACCAGCTTTAAGAGAAGGTTTA CCATTGAGAGAAGGTACTGAGAGATCTGCTTACTACACCTGGGCTGCCGAAGCTTTCAGA GTTGCTACTTCTGGTGTTGCTAACAAGACTCAAATACACTCTCATTTCTGTTACTCTGAC TTGGATCCAAACCATATCAAGGCTTTGGATGCTGATGTTGTTTCCATCGAATTCTCTAAG AAGGACGATGCTAACTACATTGCTGAATTCAAAAACTATCCAAACCACATTGGTCTAGGT TTATTCGATATTCATTCTCCAAGAATTCCATCAAAGGATGAATTTATCGCCAAGATTTCA ACCATCTTGAAGAGCTACCCAGCTGAAAAGTTCTGGGTTAACCCAGATTGTGGTTTGAAG ACTAGAGGCTGGGAAGAAACTAGATTGTCTTTGACTCATATGGTCGAAGCCGCCAAGTAC TTCCGTGAACAATACAAGAATTAA
Protein Properties
Pfam Domain Function
Protein Residues767
Protein Molecular Weight85859.20313
Protein Theoretical pI6.41
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MVQSAVLGFPRIGPNRELKKATEGYWNGKITVDELFKVGKDLRTQNWKLQKEAGVDIIPS NDFSFYDQVLDLSLLFNVIPDRYTKYDLSPIDTLFAMGRGLQRKATETEKAVDVTALEMV KWFDSNYHYVRPTFSKTTQFKLNGQKPVDEFLEAKELGIHTRPVLLGPVSYLFLGKADKD SLDLEPLSLLEQLLPLYTEILSKLASAGATEVQIDEPVLVLDLPANAQAAIKKAYTYFGE QSNLPKITLATYFGTVVPNLDAIKGLPVAALHVDFVRAPEQFDEVVAAIGNKQTLSVGIV DGRNIWKNDFKKSSAIVNKAIEKLGADRVVVATSSSLLHTPVDLNNETKLDAEIKGFFSF ATQKLDEVVVITKNVSGQDVAAALEANAKSVESRGKSKFIHDAAVKARVASIDEKMSTRA APFEQRLPEQQKVFNLPLFPTTTIGSFPQTKDIRINRNKFNKGTISAEEYEKFINSEIEK VIRFQEEIGLDVLVHGEPERNDMVQYFGEQINGYAFTVNGWVQSYGSRYVRPPIIVGDLS RPKAMSVKESVYAQSITSKPVKGMLTGPITCLRWSFPRDDVDQKTQAMQLALALRDEVND LEAAGIKVIQVDEPALREGLPLREGTERSAYYTWAAEAFRVATSGVANKTQIHSHFCYSD LDPNHIKALDADVVSIEFSKKDDANYIAEFKNYPNHIGLGLFDIHSPRIPSKDEFIAKIS TILKSYPAEKFWVNPDCGLKTRGWEETRLSLTHMVEAAKYFREQYKN
References
External Links
ResourceLink
Saccharomyces Genome Database MET6
Uniprot IDP05694
Uniprot NameMETE_YEAST
GenBank Gene IDDQ393811
Genebank Protein ID88910023
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Boucherie, H., Dujardin, G., Kermorgant, M., Monribot, C., Slonimski, P., Perrot, M. (1995). "Two-dimensional protein map of Saccharomyces cerevisiae: construction of a gene-protein index." Yeast 11:601-613.7483834
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956